KEGG   Pectobacterium parmentieri SCC3193: W5S_2156Help
Entry
W5S_2156          CDS       T02514                                 

Definition
(GenBank) rRNA (Guanine-N1-)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
pec  Pectobacterium parmentieri SCC3193
Brite
KEGG Orthology (KO) [BR:pec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pec03009]
    W5S_2156
Enzymes [BR:pec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     W5S_2156
Ribosome biogenesis [BR:pec03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    W5S_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_32 Ubie_methyltran Methyltransf_12 Methyltransf_23 MTS Methyltransf_29 MetW Methyltransf_18 CheR Methyltransf_33 PCMT tRNA_U5-meth_tr CMAS Methyltransf_4 Methyltransf_9 NodS Pox_MCEL
Motif
Other DBs
NCBI-ProteinID: AFI90245
UniProt: A0A0H3I3N3
Position
2342860..2343690
Genome map
AA seq 276 aa AA seqDB search
MSYQCPLCQLPLERHPRQWTCGKHSFDCAKEGYVNLLPVQFKRSKQPGDSAEMMQARRSF
LEAGHYQPLRDAVAQHIDNIVADDATALLDIGCGEGYYTAELARRLTSRKAMAIYGLDVS
KAAIQRAAKRYDNVEFCVASSQRLPFRDASLDAVVKIYAPCNDAELQRTVKVGGWVVTVS
PGPRHLYQLKAEVYEEVLLHPSKDEMLTGFQLMEQQVLAYPMQLSGNEAAALLQMTPFAW
RATPEVSQRLQTTTQFSCETDFIIRLHQRVDIDVID
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagttatcagtgtccgctatgccagttacctctggagcgacacccgcggcaatggacg
tgtggtaaacatagctttgattgtgcgaaagaagggtacgttaacctgttgccggtacag
tttaagcgctcaaagcagcccggcgatagtgctgaaatgatgcaggcccggcgcagtttt
cttgaagctggtcattatcaaccgctacgcgatgcggtggcgcaacatattgataatatc
gtggcggatgacgcaaccgcactgctggatatcggctgtggagaagggtattacaccgca
gagttggcccgtcgtctcacatcgcgcaaggcgatggcgatatacggactagatgtttcc
aaagcagcgattcaacgtgcggcaaagcggtatgataacgtggagttttgcgttgcatcc
agccagaggctgccttttcgcgatgcatcccttgatgcagtggtaaaaatctatgcgccg
tgtaatgacgcagaactacagcgcacggttaaggttggcggttgggtggtgacggtgtcc
ccggggccacgtcatctgtatcaactgaaggctgaagtttacgaggaggtgttattacat
ccaagtaaagacgaaatgcttaccggctttcagcttatggaacagcaggtgctcgcgtat
cccatgcagttatctgggaacgaagcggcggctctattgcaaatgacccccttcgcctgg
cgggcaacgccagaagtcagccaacggttacagacaaccacccagtttagttgtgaaacg
gatttcattatccgactacatcagcgtgttgatattgatgttatagattga

DBGET integrated database retrieval system