KEGG   Pectobacterium parmentieri SCC3193: W5S_2228Help
Entry
W5S_2228          CDS       T02514                                 

Definition
(GenBank) Aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pec  Pectobacterium parmentieri SCC3193
Pathway
pec00010  Glycolysis / Gluconeogenesis
pec00071  Fatty acid degradation
pec00350  Tyrosine metabolism
pec00620  Pyruvate metabolism
pec00625  Chloroalkane and chloroalkene degradation
pec00626  Naphthalene degradation
pec00650  Butanoate metabolism
pec01100  Metabolic pathways
pec01110  Biosynthesis of secondary metabolites
pec01120  Microbial metabolism in diverse environments
pec01130  Biosynthesis of antibiotics
pec01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    W5S_2228
   00620 Pyruvate metabolism
    W5S_2228
   00650 Butanoate metabolism
    W5S_2228
  09103 Lipid metabolism
   00071 Fatty acid degradation
    W5S_2228
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    W5S_2228
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    W5S_2228
   00626 Naphthalene degradation
    W5S_2228
Enzymes [BR:pec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     W5S_2228
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     W5S_2228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AFI90316
UniProt: A0A0H3I8Q1
Position
complement(2408673..2411351)
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVRKAQQEFATYTQEQVDKIFRAAALAASDARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYQDEKTCGILSTDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIIGWIDQPSVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSAYDAVRERFATHGGYMLKGKELHAVQGILLKNGSLNADIVGQP
APKIAEMAGITVPANTKVLIGEVTAVDESEPFAHEKLSPTLAMYRAKDFNDAVIKAEKLV
AMGGIGHTSCLYTDQDNQPERVNHFGNMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVASDGAK
RAFIVTDRFLFNNGYVDQVTSVLKHHGLETKVFFEVEADPTLSIVRKGAEQMHSFKPDVI
IALGGGSPMDAAKIMWVMYEHPTTHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHSLE
AYVSVLANEYSDGQALQALKLLKENLPDSYRDGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLISNVIRYNANDNPTKQTTFSQYDRPQARRRYAEVAD
HLRLTAPSDRTAQKIEKLLNWLEEIKTELGIPTSIRDAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRKFSEDVKTEAIEPPVAKAAKTSKKAAH
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaaccaacgttgctgaacttaacgcattggtcgaaagagtaagaaaggcacag
caggaatttgccacttacactcaggaacaagtagataagatcttccgcgctgctgcactc
gctgcatcggatgcccgtatcccactggcaaaaatggcagttgccgaatccggcatgggg
atagtggaagataaagtcatcaaaaaccacttcgcatccgaatacatttataacgcctat
caggatgaaaaaacctgcggcattctctctactgatgacactttcggtaccattaccatt
gcagagcctattggcctgatttgcggtattgttcccaccaccaaccctacttctaccgcg
atttttaaagcgctgatcagcctgaagacccgtaatggaattatcttctctcctcatccg
cgtgcaaaaaatgcgaccaataaagccgcagatatcgtgctgcaagcggcaattgccgca
ggcgcaccgaaagatatcattggctggattgaccagccttctgtcgagttgtctaaccaa
ctgatgcaccacccggatatcaacctgattctggctacgggtggcccaggtatggtgaag
gccgcgtacagttcaggtaaaccggcaatcggtgtaggtgccggtaacacccccgttgtc
gttgacgaaactgcagacatcaagcgtgccgtcgcctctattttgatgtcgaaaaccttc
gataacggtgtcatttgtgcgtccgagcagtctgtcatcgtggtagacagtgcctatgat
gccgtgcgtgagcgttttgctacccacggcggctacatgctgaaaggcaaagaacttcat
gccgtacagggaattctgctaaaaaacggttcactgaatgccgacatcgtgggccaacca
gcaccgaaaattgcagaaatggcgggcatcaccgtcccagcaaacaccaaagtgctgatt
ggtgaggtaacagccgtcgatgaatccgaaccgtttgcccatgaaaaactttctccgaca
ctggcgatgtaccgtgcgaaagacttcaacgacgccgtcattaaagcggaaaaactggta
gcaatgggtggcatcggtcacacatcctgcctgtataccgatcaggacaatcagccagaa
cgcgtaaatcatttcggtaatatgatgaaaacggcgcgcatcctgattaatactcccgct
tctcagggcggtatcggcgatctctacaacttcaaactcgcgccgtctctgacgctgggc
tgcggctcctggggaggaaactccatctccgaaaacgtcggtccgaagcacttgatcaac
aagaaaacggtagccaagcgagcagagaatatgttgtggcataaacttcccaagtctatt
tatttccgtcgcggctcactgccaatcgcacttgaagaagtcgcctccgatggtgcaaaa
cgtgcatttatcgtgaccgaccgtttcctgttcaacaacggttacgtcgatcaagtcact
tccgtactgaaacatcacggactggaaaccaaggttttctttgaagttgaagctgatccg
acactgagcatcgtgcgtaaaggtgcagagcaaatgcactccttcaagccagatgtgatt
attgcgctgggcggaggttcgccaatggatgcggcgaagatcatgtgggtaatgtatgag
cacccgacgacgcatttcgaagagttggcactgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtcaaagccaaaatggtggcaataaccaccacatctggt
acgggttccgaggttacgccgtttgccgtggtgacggacgatgcaaccgggcagaaatat
ccgttggcagactatgcactgacgccagatatggcgattgttgatgccaacctggtgatg
aatatgccgaaatcactgtgtgcatttggtgggctcgatgccgtaacgcactcgctggaa
gcctatgtttccgtgctggcaaacgaatattcggacggccaggcgttacaagcgttgaaa
ttactaaaagagaatttgccagacagctaccgtgatggcgcaaaaaacccagtagcccgt
gagcgcgtgcataacgccgcaacgattgccggtatcgcgtttgccaacgccttcctcggc
gtctgtcactcaatggcgcacaagttgggctcggagttccatattccgcacggtctggcg
aacgccctactaatctcaaacgtgatccgctataacgcaaacgacaatccgaccaagcag
acgacgttcagccagtatgaccgccctcaggctcgccgtcgttacgcggaagtcgctgac
cacctgcgtttgactgccccaagcgatcgtaccgcgcagaaaatcgagaaattgctgaac
tggttggaagaaataaagactgagttggggatcccgacgtccatccgtgacgctggcgta
caggaagccgattttctggcgaaggtcgataagttgtctgaagatgcgttcgacgatcag
tgtactggcgctaacccgcgctatccgctgatttccgaattgaaacaaattctgctggat
acttactatggtcgtaagttttctgaagacgtaaaaacagaagcgattgaaccacccgta
gcaaaagccgccaaaaccagtaagaaagccgcacattaa

DBGET integrated database retrieval system