KEGG   Pectobacterium parmentieri SCC3193: W5S_3169Help
Entry
W5S_3169          CDS       T02514                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pec  Pectobacterium parmentieri SCC3193
Pathway
pec00071  Fatty acid degradation
pec00280  Valine, leucine and isoleucine degradation
pec00310  Lysine degradation
pec00362  Benzoate degradation
pec00380  Tryptophan metabolism
pec00620  Pyruvate metabolism
pec00630  Glyoxylate and dicarboxylate metabolism
pec00640  Propanoate metabolism
pec00650  Butanoate metabolism
pec00900  Terpenoid backbone biosynthesis
pec01100  Metabolic pathways
pec01110  Biosynthesis of secondary metabolites
pec01120  Microbial metabolism in diverse environments
pec01130  Biosynthesis of antibiotics
pec01200  Carbon metabolism
pec01212  Fatty acid metabolism
pec02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    W5S_3169
   00630 Glyoxylate and dicarboxylate metabolism
    W5S_3169
   00640 Propanoate metabolism
    W5S_3169
   00650 Butanoate metabolism
    W5S_3169
  09103 Lipid metabolism
   00071 Fatty acid degradation
    W5S_3169
   00072 Synthesis and degradation of ketone bodies
    W5S_3169
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    W5S_3169
   00310 Lysine degradation
    W5S_3169
   00380 Tryptophan metabolism
    W5S_3169
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    W5S_3169
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    W5S_3169
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    W5S_3169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pec04147]
    W5S_3169
Enzymes [BR:pec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     W5S_3169
Exosome [BR:pec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   W5S_3169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFI91243
UniProt: A0A0H3IBD7
Position
3400560..3401738
Genome map
AA seq 392 aa AA seqDB search
MNDSIVIVNAKRTAIGKFAGSLANTSAIEMASATIRDCLSTLPDTLAIDEVILGNVLQAG
LGQNPAHQASQAAGLSFEIPSLTVSKVCGSGLKAVVLGAQSILSGDNQVCVTGGMENMSA
APYLLEKARHGYRMGDGKLVDIMINDGLWCAFNDYHMGTTAENIAERYQLTREEQDRVAL
ASQQKAVAAIEAGRFKAEITPLSLRSKKETRIFDRDEFPRADTTLASLTALRPAFSANGT
VTAGNASGINDAAATLVLMRESEAKKQGITPLARIRSWASAGVPSEVMGLGPIPATQKAL
LKAGLTIDDIDLIEANEAFAAQFLAVQRDLQLDPEKVNVNGGAIALGHPIGASGARILVT
LVHALHSYNKTLGLATLCIGGGQGIAMIVERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactccattgttattgttaatgccaagcgcaccgcaattggtaaatttgcaggc
agtctggccaacacctctgccatcgagatggcctctgccaccatccgcgactgcctgtcg
acgctgccggacacgctggcgatcgatgaagtgattctcggcaacgtgctgcaagccggt
ctgggacaaaaccccgcgcatcaggccagccaagctgccggtctgtcttttgaaattcct
tcgctgaccgtcagcaaagtatgcggttccggcctgaaagccgttgtgctgggtgcacag
tctattctgtccggcgataatcaggtctgcgtgacgggcggaatggaaaacatgagcgcc
gcgccttacctgctggaaaaagcgcgccacggctaccgcatgggagatggcaagctcgtt
gacatcatgattaacgacggcctgtggtgtgcgtttaacgattaccacatgggcaccacg
gcggaaaatatcgccgagcgctatcagctcacgcgagaagaacaggatcgggtggcgctg
gcgtcgcagcagaaagcggtcgccgcgattgaagcgggtcgtttcaaagccgaaattacc
ccactgtcgctgcgtagcaaaaaagagacacggattttcgatcgggacgagttccctcgc
gcagacaccacgctggcgtcgttgacagcgttacgtccggcattctccgcgaatggcacc
gtcaccgctggcaacgcatccggcattaacgatgccgccgcgacgctggtgttaatgcgt
gaatccgaagcgaaaaaacagggtattaccccgctggcgcgtatccgtagctgggcttcg
gctggcgtaccgagtgaagtcatgggtctgggaccaattccggcgacgcagaaagcgctg
ctcaaggctgggttgacgattgatgatattgacctgattgaagccaatgaagcctttgcc
gcgcagtttctagccgtacagcgcgatctccaactagacccagaaaaggtgaatgttaac
ggcggtgcgattgcattgggtcaccctatcggcgcgagcggtgcccgtattctcgttacg
ctggtacatgcgctgcacagctataacaaaacgctggggttggcgacgctgtgcatcggc
ggcgggcaaggtatcgccatgatcgtcgagcgcgtttaa

DBGET integrated database retrieval system