KEGG   Pectobacterium parmentieri SCC3193: W5S_3961
Entry
W5S_3961          CDS       T02514                                 

Definition
(GenBank) RhsF
Organism
pec  Pectobacterium parmentieri SCC3193
SSDB
Motif
Pfam: RHS_repeat DNase_NucA_NucB DUF4595 RHS DUF1513 PEP-utilizers
Other DBs
NCBI-ProteinID: AFI92024
UniProt: A0A0H3ID66
Position
4278202..4280940
AA seq 912 aa
MDGDHQGRCIYTTCADGYLTANFEYLADRVVMIDGLGQRHEYGFNDLYLMAWEKSPLGHL
TRYEYDDVGNLLREISPAGRAVEFAYLGDSGLVSTFTDGSGHAWHYAYDDHERLIGITDP
LGRRWVWQYDNNGNPLSLTGPDASEMRFAWNRYGLLTEVSDQNGHVQASLFYDHRQRLLS
ATDAEARTQQLRYDQQDRLTTWTRPDGATYRLGYRRASWRLPEQLIRPDEKEEKRQYDKH
NNLLNYTDGNGAVWQQTYGPFDLLTSRTDAEGRTWQYDYDKDSQQLIGVTAPDGNRWQWW
LDADGRVIRERDMAGTETHYGYDEDGHCISVRNGEGEIRHFLYDGRGLLIKETAPDDTLY
YRYDAAGRLTDVTSTTSHVQLEYDERDRVVQEHNSGTAIRRHYQDASHTVTRSLHWEGEE
DSAALTSTFCYRATGELHQVQLPDGAALTLAHDGAGRESSRQSQAGFMQHREYDAMGWLT
REMSGQTVDGRLQPVQTREYLYDGAGNLTGTRRNREAAGYRLDASGRVLSVLSGGAGRTV
NTEEEYRYTRSGLPQDATRLTDWQAGRLTQQDNTHYQYDKAGRLIRRQVVQPGYRPQVWH
YRWDSRNQLRVVDTPTGERWLYRYDPFGRRIGKRCDQTQDDIRYLWDGDQIAEVRHSRDN
QLVSRRHWVHNGWELLVQQRQNADASWETDFVTSGHNGEPQAVFNPQGELRWQAPRANLW
GQRYTENAEKYDPGLAFAGQYRDDESGLCYNRFRYYDPSGGCYISPDPIGIAGGDNNYGY
VYNPVSWVDPFGLAGCSLIKSSSKDYDYILKLKRTEYPQTFGHIDDAIGKGHPDIVTINR
GTAKSNRKVSLKDVKTKTGYDRDEWPMAMFKEGGNGASVRYINPSDNRGAGSSIGNILSD
LPDGTRIKVEIL
NT seq 2739 nt   +upstreamnt  +downstreamnt
atggatggcgaccatcagggacgctgtatctacaccacctgtgccgatggctacctgacg
gcgaatttcgagtacctggctgaccgcgtggtgatgattgacgggctgggacagcgccat
gaatacggcttcaacgacctgtacctgatggcgtgggaaaaatctccgctcggccatctc
acccgctatgagtatgacgatgtgggcaacctgctgcgggaaatttccccggcgggtcgg
gcagtggaatttgcctatctgggcgacagcgggctggtcagcacctttaccgacggcagc
ggccacgcgtggcactacgcctatgacgaccacgagcgacttatcggtattaccgacccg
ctggggcgccgttgggtctggcagtacgacaataacggcaacccgctgagtctgaccggg
ccggatgcgagcgaaatgcggtttgcctggaaccgctacggcctgctgaccgaagtgagc
gaccagaatggacacgtgcaggccagcctgttttacgaccaccgtcagcgcctgttgagc
gccaccgatgcggaagcccgcactcagcaactgcgctacgaccagcaggacagactgacc
acctggacacgcccggatggtgccacctatcggctgggttatcgccgggcaagctggcga
ctgccggagcaactgatacgcccggacgagaaagaggaaaaacgccagtacgacaagcat
aacaacctgctgaactacaccgacggcaacggtgcggtctggcagcaaacctacggcccg
ttcgacctgctgacttcacgcaccgacgctgaaggccgcacctggcagtacgactatgat
aaagacagtcagcaactgattggtgtcaccgccccggatggcaaccgctggcagtggtgg
ctggatgcggacggacgggttatccgtgagcgggacatggccggtacggaaacccactac
ggctatgacgaagacgggcactgcatcagcgtgcgcaatggcgaaggggaaatccgccac
tttctgtacgacgggcgcggcctgcttatcaaagaaaccgcgccggacgatacgctgtat
taccgctatgatgcggccggtcgactgaccgacgtgacatcgaccaccagtcatgtccag
cttgaatatgacgagcgtgaccgggtggtacaggagcataacagcggcacggcaatccga
cgccactatcaggacgcatcgcacaccgttacccgcagcctgcactgggaaggcgaagag
gacagcgcggcactgaccagcaccttctgctaccgcgccacgggcgaactgcatcaggtg
cagttgccggacggcgcagcactgacgctggctcacgacggtgcgggtcgtgagtcttcc
cggcagagtcaggctggctttatgcagcaccgtgaatacgatgccatgggctggctgacg
cgggagatgagcgggcagacggtagacggtcgcctgcagccggtacagacgcgggaatac
ctctacgatggcgcgggtaacctgacgggcacccgacgcaaccgcgaagcggcaggttac
cgactggatgccagcggacgggtgctgtcggtactgagcggtggtgcggggcgcaccgtc
aacaccgaagaggaataccgctacacccgcagcgggctgccgcaggatgcgacaaggctg
accgactggcaggccggacgcctgacccagcaggacaacactcactatcagtacgacaag
gccgggcggctcattcgcaggcaggtggtgcaaccgggctatcggccacaggtgtggcac
taccgctgggacagccgcaaccagttgcgggtagtggacacgccgaccggtgagcgctgg
ctctaccgttacgacccgttcgggcggcgcattggcaaacgctgcgaccagacccaggac
gatatccgttacctgtgggacggcgaccagatagcggaggtgcggcactctcgcgacaat
caacttgtctcacggcgccactgggtgcacaacggctgggaactgctggtgcagcagcgc
cagaacgccgacgcaagctgggaaaccgactttgtgaccagcggtcataatggcgaaccg
caggcggtctttaatccgcaaggcgaactgcgctggcaggctccgcgcgctaatttatgg
ggccagcgctatacggaaaacgctgaaaaatatgatccggggctggcatttgccggacaa
taccgtgacgacgaaagtggcttatgctataaccgtttcaggtattatgacccgagcggt
ggttgttatatctcgcctgacccgatagggatagcggggggagataataactatgggtat
gtgtataaccctgtcagttgggttgatccgtttgggttggcgggatgttccttaataaaa
tcatcctccaaggattatgattacatcttaaagttgaagcgtactgaatacccgcaaaca
tttggtcatattgatgacgctattgggaaaggtcatccagatatcgtgactatcaataga
ggaacggccaagtcaaataggaaagtgagtttaaaagatgtaaagacaaagactgggtat
gatcgtgacgaatggccaatggctatgtttaaagagggcggaaatggtgcaagtgtcagg
tatattaatcctagcgataatcgcggcgccggctcaagcattggtaatattttgtcggat
ttacctgatggaactagaattaaagtggagattttataa

DBGET integrated database retrieval system