KEGG   Pectobacterium parmentieri SCC3193: W5S_4605Help
Entry
W5S_4605          CDS       T02514                                 

Definition
(GenBank) Pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
pec  Pectobacterium parmentieri SCC3193
Pathway
pec00040  Pentose and glucuronate interconversions
pec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    W5S_4605
Enzymes [BR:pec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     W5S_4605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-ProteinID: AFI92651
UniProt: P55743
Position
4947191..4948393
Genome map
AA seq 400 aa AA seqDB search
MTKTTYPGTAYRPILSEQEADRFTLPHYFTRRGHDGHSDTDVWQPTSIEVDPATPWVVGP
QVGVDGATHGTVQQAVNAALRAQQDRPCIDIKLLPGIYTGAVYIPADAPPLTLFGTGEQP
NDVVIQLALDSMFSPATYRETVNSHGEYQPGDPAWYMYDLCASKQNATIDTICAAVVWSQ
SDNLQMKNLTVVNALLDSVDGRAHQAVALRTDGDKIQLERVRLIGRQDTFFVNTSNLRNE
YVTDRYSRAYIKDSYIEGDVDYVFGRATAVFDRVHFHTVSSRGAKDIHVFAPDSMPWAQY
GFLAVSCRFTGDEGFSGGRKAKLGRAWDQGARQTGYQPNKTANGQLVIRDSTIDASYDRE
QPWGVAATTARPFAGNVDSARNLDDVQFNRLWEYNNIDEV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaacaacctatcccggcaccgcttaccgccccatcctctctgagcaggaagcg
gatcgcttcacgctcccgcactactttacgcggcgtgggcacgatgggcattctgacact
gacgtttggcaacctacgtcgattgaggtcgatccggctacgccgtgggttgtcgggcca
caggtcggggtggatggcgcaacacacggtacagtgcaacaggcagtcaacgccgcgcta
cgggcgcagcaggatcggccgtgtattgatattaaattgctaccgggcatctatactgga
gcggtctacatccccgccgatgcgccaccgctcacgctatttggcacaggagagcaaccg
aatgacgtggtgattcaactcgcgctggattcgatgttttcaccagcaacctaccgagaa
acagtgaactcacatggtgaatatcaacccggtgacccagcctggtacatgtacgatctc
tgtgcatcaaagcaaaacgcgacaattgatactatctgtgccgccgtggtctggtcgcag
agtgacaatttacagatgaagaacctgacggtggtaaatgcattgctggattcagtcgat
ggccgagcacatcaggccgtggcgctgcgcaccgatggcgacaaaatacagcttgaaagg
gttcgcctgatcgggcgtcaggatacatttttcgttaatactagtaacctccgcaacgag
tacgtcacagaccgctacagccgcgcctacattaaagacagttacattgaaggtgatgtc
gattatgtttttggccgggcgaccgcagtattcgatcgcgtccactttcacacggtttcc
agtcgcggcgcaaaagacattcatgtttttgcacctgacagcatgccgtgggcgcaatac
ggttttctggcggtaagttgccgctttacgggagacgaaggcttcagtgggggaagaaag
gccaaactgggacgcgcctgggatcagggggcaaggcagacaggataccagcccaacaag
acggcaaatggccagctagtcattcgtgacagtacgattgacgccagctatgacagagaa
caaccttggggagtcgctgcaactaccgcgcggccttttgcaggtaacgtggattcagcc
cgtaatctggatgatgtgcaattcaatcggctgtgggaatacaacaatatcgacgaggtg
tga

DBGET integrated database retrieval system