KEGG   Pectobacterium parmentieri SCC3193: W5S_4624Help
Entry
W5S_4624          CDS       T02514                                 

Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pec  Pectobacterium parmentieri SCC3193
Pathway
pec00051  Fructose and mannose metabolism
pec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    W5S_4624
Enzymes [BR:pec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     W5S_4624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AFI92670
UniProt: A0A0H3IB57
Position
complement(4970029..4971177)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADANVELTFADVNQPLLDALNSRKSYTVRIVGDNTQVDTV
SNVSAVHSGSQDAVALIAVADLVTTAVGPQILEKIAGTIAQGLVKRHEDGNTRPLNIIAC
ENMVRGTSQLKQHVLKLLPEGHQEWVVEHVGFVDSAVDRIVPPSEAGSDDVLAVTVETFS
EWIVDKTQFCGELPAIPGMELTDNLMAFVERKLFTLNTGHAITAYLGQQARHQTIRDAIL
DPKVRAVVKGAMEESGAVLIKRYGFDADKHAAYINKILSRFENPHLHDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYHLPHDNLITGIAAAMHYRSEQDPQALELAELIRTQGAQAALVQ
ISGLDADSKVVAQAVNVYNAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcgggtaatattggccgcgggtttattgggaaattgttg
gccgatgccaacgtcgagttgacattcgctgacgtcaatcagccgctgttggatgctctc
aacagccgtaaaagctacacggtgcggattgtcggtgataacacgcaggttgatactgtc
agcaatgttagcgctgttcacagcggcagtcaggatgctgttgcgctgattgccgtggcc
gatctggtgacgactgctgtggggccgcagattctggaaaaaatcgccggaactattgct
caggggctggttaagcgtcacgaagacggcaatacccggccgttgaacattattgcctgt
gaaaatatggtgcgtggcaccagccagctaaaacaacatgtgctgaaactgctgccagaa
ggccatcaggaatgggtggttgagcatgtgggattcgtcgattctgccgtggatcgcatt
gttcccccttccgaagcgggcagtgatgatgtgctggcggtgacggtagaaaccttcagt
gaatggatcgtcgataaaactcagttttgtggtgagttgcctgcgattcccggtatggaa
ttgaccgacaacctgatggcgttcgttgagcgtaagctgttcacactcaacactggccat
gcgattacggcttaccttggccagcaggcgcgccatcaaacgatccgcgatgcgattctt
gacccgaaagtcagagccgtggtcaaaggcgcaatggaagagagcggtgcggtacttatc
aaacgctacggttttgatgcggataagcacgccgcctatatcaacaaaattctcagccgc
tttgaaaacccccatctgcatgacgatgtggagcgcgttggccgtcagccgctgcgcaag
ctgagtgccggtgaccgtctgatcaagccgctgctcggaacgctggaataccatttgccg
catgacaacctgattaccggcattgctgccgcgatgcactatcgcagcgaacaagatccg
caagcgctggagctggctgaattaatccgcacacagggtgcgcaggcggcgctggtgcag
atttctggtctggatgctgacagcaaggttgtcgcgcaagcagtgaatgtgtataacgcc
atgcagtaa

DBGET integrated database retrieval system