KEGG   Pectobacterium parmentieri SCC3193: W5S_4718Help
Entry
W5S_4718          CDS       T02514                                 

Definition
(GenBank) Sensor protein QseC
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
pec  Pectobacterium parmentieri SCC3193
Pathway
pec02020  Two-component system
pec02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    W5S_4718
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    W5S_4718
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pec01001]
    W5S_4718
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pec02022]
    W5S_4718
Enzymes [BR:pec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     W5S_4718
Protein kinases [BR:pec01001]
 Histidine kinases
  OmpR family
   W5S_4718
Two-component system [BR:pec02022]
 OmpR family
  QseC-QseB (quorum sensing)
   W5S_4718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N HAMP SdrG_C_C
Motif
Other DBs
NCBI-ProteinID: AFI92758
UniProt: A0A0H3ICG7
Position
5072894..5074243
Genome map
AA seq 449 aa AA seqDB search
MNRLSLRLRLVAGFTLLTVMCWGVASLLAWSQTRHNINELFDTQQMLFAKRLATMNPDEL
RIQPASLPKTKSLVHKNRGKQDDDTLAFAIFTHDGKMVLNDGENGKDFIFDATRNGFTDG
KLRDDNDAWRIVWLTTEDNRYVIAVGQEWEYRQDMTLDIVKTNLMPWLFALPIMLALLFW
LVTRELSPLKRITAELQQRSPDDSTSLATQHIPQEVRPLVNALNLLFSRISDMLLRERRF
TSDAAHELRSPLAALKVQTEVAQLAHDDEAMRRHALMNLDKGIDRATRLVDQLLTLSRLD
AESHPEGMQPVQFNELLQQAAIAHYHTAQTADIELKLDLPDTPVIRQGHPLLLTLLVRNL
LDNAIRYSNAGGTVSLTLTERGFKVADNGPGISDEALARIGERFYRPPGQEKSGSGLGIS
IVNNIATLHHMRVAFTNQPGGGLIVSVNW
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgactcagcctgcgtttacgcctggttgcgggttttacgctgctgacagtaatg
tgctggggtgtagccagtctgcttgcgtggtctcaaacgcgccataacatcaatgaacta
tttgatacccagcaaatgctgtttgccaaacgtctggccaccatgaatcccgatgaattg
cgaatccagccagcatctctgcccaagaccaaaagcctggtacataaaaaccgaggtaaa
caggatgatgatacgctggctttcgccatttttacccacgatggaaaaatggtgttgaac
gatggtgaaaacggcaaagatttcatttttgacgctacacgcaacggcttcaccgacggc
aaactgcgcgatgataacgacgcatggcgtatcgtctggctgacgacagaggataatcgt
tacgtgattgcagtgggtcaggaatgggaataccgtcaggatatgacactagatattgtg
aaaaccaacctgatgccctggctgttcgccctgccgatcatgctggcactgctgttctgg
ctggtgacacgtgaactctcgccgctaaaacgcattaccgccgaacttcagcagcgctcc
cccgacgacagcacatcgctggcgacacagcatatcccacaagaagtccgcccactggtc
aacgcgctgaacctcctgttttcccgcatcagcgatatgttgcttcgcgaacgccgtttt
acctctgatgcggctcatgaattgcgtagcccgctggcggccctgaaagttcaaaccgaa
gtcgcgcagctagcgcatgacgatgaggccatgcgtcgccatgcattaatgaatctggat
aaaggtatcgatcgcgccacccggctggtagatcaactcctgacgctgtcgcggctagat
gcagaatcacatcccgagggaatgcagcccgttcagttcaatgaattactgcaacaggcc
gccatcgcgcattaccacacggcacaaaccgcagatattgaactgaagctggatttaccg
gataccccagttattcggcaaggtcatccactgctgctgaccctgctggtgcgcaatctg
ttagataacgccattcgctacagcaatgcagggggaacggtcagcctgacgctgacagaa
cgcggctttaaagtagccgataacgggccgggcatcagcgatgaagcgctggcaagaatc
ggcgagcgtttttatcgcccaccggggcaggaaaaatctggcagcggtctgggaatttcc
atcgtgaacaatatcgccacgctgcatcacatgcgggttgctttcaccaaccagcccgga
ggcgggctgattgtgtcggtgaattggtag

DBGET integrated database retrieval system