KEGG   Pseudonocardia sp EC080619-01: AD017_02715Help
Entry
AD017_02715       CDS       T04234                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pecq  Pseudonocardia sp EC080619-01
Brite
KEGG Orthology (KO) [BR:pecq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pecq03009]
    AD017_02715
Enzymes [BR:pecq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     AD017_02715
Ribosome biogenesis [BR:pecq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AD017_02715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ALL80396
UniProt: A0A0N7JYU0
Position
complement(584281..585213)
Genome map
AA seq 310 aa AA seqDB search
MGELRSMPVPDGLDGMRIDAGLSRLLGLSRTVVAGLAEEGRIQVDGRDAGKSDRLPGGSW
LEVELPDAAAPAVIEGPAEVVAGLSVLHDDEDIVVVDKPVGVAAHPSPGWTGPTVTGGLA
ALGYRLSTSGAAERQGIVHRLDVGTTGVMVVATSEHAYTALKRAFKERTVEKRYHAVVQG
HPDPSSGTIDAPIDRHPRHDYRFAVLQGGKPSITHYDTIEAFRSASLLDVHLETGRTHQI
RVHFSALRHPCVGDLTYGADPTLAKRVGLSRQWLHARTLGFEHPADGRYVEFTSPYPDDL
ASALAALREP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagctgcggagcatgcccgtccccgacgggctcgacgggatgcggatcgacgcc
gggctgtcccggctgctggggctgtcgcggacggtcgtcgcggggctggccgaggagggc
cggatccaggtcgacggccgcgacgccggcaagtccgaccggctgccgggcgggtcctgg
ctggaggtcgagctgcccgacgccgccgcgccggccgtcatcgagggacccgccgaggtc
gtcgccggcctgtcggtgctccacgacgacgaggacatcgtcgtcgtggacaagccggtc
ggggtcgccgcgcacccgtcgccgggctggaccgggccgaccgtcaccggcgggctcgcc
gcgctcgggtaccggctgtcgacgtccggggcggccgagcggcagggcatcgtgcaccgg
ctcgacgtcggtaccaccggggtgatggtcgtcgcgacgtccgagcacgcgtacacggcg
ctgaagcgggcattcaaggagcggaccgtcgagaagcggtaccacgcggtcgtgcagggg
caccccgacccgtcgtcgggcaccatcgacgcgccgatcgaccggcacccgcgtcacgac
taccggttcgccgtcctgcagggcggcaagcccagcatcacccactacgacacgatcgag
gcgttccgctcggccagcctgctggacgtgcacctcgagacggggcgcacccaccagatc
cgggtgcacttctccgcgctgcgccacccgtgtgtcggcgacctgacctacggcgccgac
ccgacgctggcgaagcgggtggggttgtcccggcagtggctgcacgcgcgcaccctcggc
ttcgagcaccccgccgacggccggtacgtcgagttcaccagcccctaccccgacgacctg
gcctcggcgctcgcggcgctgcgggaaccgtga

DBGET integrated database retrieval system