KEGG   Pseudonocardia sp EC080619-01: AD017_12120Help
Entry
AD017_12120       CDS       T04234                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
pecq  Pseudonocardia sp EC080619-01
Pathway
pecq00330  Arginine and proline metabolism
pecq00360  Phenylalanine metabolism
pecq00380  Tryptophan metabolism
pecq00627  Aminobenzoate degradation
pecq00643  Styrene degradation
pecq01100  Metabolic pathways
pecq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pecq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AD017_12120
   00360 Phenylalanine metabolism
    AD017_12120
   00380 Tryptophan metabolism
    AD017_12120
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AD017_12120
   00643 Styrene degradation
    AD017_12120
Enzymes [BR:pecq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     AD017_12120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ALL81746
UniProt: A0A0P0SBU6
Position
complement(2585681..2587099)
Genome map
AA seq 472 aa AA seqDB search
MTTSGNASDRLTADSGAQEQAAALRAREISARELLELHLDRIAERNPELNAIVSLDPERA
RAGAAAADERLASGADVGPLHGLPFAFKDTHAAAGWRTTSGSPLFAEHVPDADDLIVERI
RRAGAVPIGKTNVPEFAAGSHTFNRVFGTTRNPHDPSRSAGGSSGGAACALASGMVPLAD
GSDMGGSLRNPASFCGVVGLRPSLGRVPAWPAQNMWETTATGGPMARSAGDLALLLSVLA
GPDPRAPHALGDPGAAFAPPLRPAPLAGLRVAVSTDLDGAFAVDPDVAAVVSSAVPALAG
AGAVVGSAVPDLTGADECFRTLRAWHFQAAFGELLAAHPDEFKATLAANIRAGASLTGAD
VARAHGQRTSLAHAARAFFADHDVLVLPVSQVPPFPADQEFPTEIDGRPMESYLDWMRSA
YLITVTGCPAISVPFGRTPGGLPVGLQIVARHGADRFLLEVAAAVEQLRPGV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccagcgggaacgcctccgaccggctcacggccgactcgggcgctcaggagcag
gccgccgcgctgcgcgcccgcgagatctcggcgcgcgagctgctggagctgcacctcgac
cggatcgccgagcggaacccggagctgaacgcgatcgtctccctcgacccggagcgggcc
cgggccggcgcggccgccgccgacgagcggctcgcctcgggcgcggacgtcggcccgctg
cacgggctgccgttcgccttcaaggacacccacgccgccgcgggctggcgcaccacctcg
ggctcgccgctgttcgccgagcacgtcccggacgccgacgacctgatcgtcgagcggatc
cggcgggccggtgcggtcccgatcgggaagacgaacgtgccggagttcgccgccggctcg
cacaccttcaaccgggtcttcgggacgacgcgcaacccgcacgacccgtcccgctcggcc
gggggctcgtccggcggggcggcgtgcgcgctggcgtccgggatggtgccgctggccgac
ggttcggacatgggtggctcgctgcgcaacccggcgtcgttctgcggggtggtggggctc
cgcccgtcactgggccgggtgccggcgtggcccgcgcagaacatgtgggagaccaccgcg
accgggggcccgatggcgcgctcggccggtgatctcgcgctgctgctgtcggtgctggcc
gggccggacccgcgcgcgccgcacgcgctcggcgaccccggtgcggcgttcgcacccccg
ctccgcccggccccgctcgccgggctgcgggtggcggtgtcgaccgacctggacggcgcg
ttcgccgtcgacccggacgtcgccgccgtcgtgtcgtcggcggtgcccgcgctggccggg
gccggcgccgtggtcggctccgcggtgcccgacctgaccggggccgacgagtgcttccgc
acgctgcgcgcctggcacttccaggccgcgttcggtgagctcctcgccgcgcacccggac
gagttcaaggcgacgctggccgccaacatccgggccggcgcgtcgctgaccggtgccgac
gtcgcgcgggcccacgggcagcgcacgtcgctcgcgcacgccgcgcgcgcgttcttcgcc
gaccacgacgtgctcgtgcttcccgtgtcgcaggtgccgccgttccccgcggaccaggag
ttcccgaccgagatcgacggccgtcccatggagtcctacctggactggatgcggtcggcg
tacctgatcaccgtcaccgggtgcccggcgatctcggtgccgttcggccggacacccggc
gggctgcccgtcgggctgcagatcgtcgcgcggcacggcgccgaccggttcctgctggag
gtcgccgcggccgtcgagcagctgcgcccgggggtgtga

DBGET integrated database retrieval system