KEGG   Pseudonocardia sp EC080619-01: AD017_24685Help
Entry
AD017_24685       CDS       T04234                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
pecq  Pseudonocardia sp EC080619-01
Pathway
pecq00770  Pantothenate and CoA biosynthesis
pecq01100  Metabolic pathways
Module
pecq_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:pecq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AD017_24685
Enzymes [BR:pecq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     AD017_24685
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     AD017_24685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_10 NmrA
Motif
Other DBs
NCBI-ProteinID: ALL83594
UniProt: A0A0P0SGH9
Position
5259646..5260869
Genome map
AA seq 407 aa AA seqDB search
MPETAPEVLLGVSGGIAAYKSAELLRRLTESGHAVRVVPTESALEFVGAATFEALSGRPV
ATGVFTDVHEVPHVALGQRADLVVVAPATADLMARLAHGRSDDLLTASLLTARCPVLLAP
AMHTEMWEHPATRDNVALLRSRGTVVLEPASGRLTGADTGKGRLPDPAEIFDLARLLLER
PDALPRDLEGRHVVVSAGGTRENLDPVRYLGNRSSGRQGWALARVAAQRGARVTLVAGHT
ADLVAPAGVEVVPAGSAGAMEAAVRSAAADADAVVMAAAVADFRPVDTAADKIKRGSAEP
PPLRLVQNPDILAGLVHDTPRPGQVIVGFAAETGDADGDVLHHGRAKLARKGCDLLVVNA
VGEGKAFETPDNAGWLLARDGGEEELPMGSKALLASRIWDAVTPRLV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagacggcaccggaggtcctgctcggcgtctcgggcggcatcgccgcctacaag
agcgcggagctgctgcgccggctgaccgagtccggtcacgccgtgcgcgtggtccccacc
gagtcggcgctggagttcgtcggcgcagccacgttcgaggcgctgtccgggcgcccggtc
gcgaccggtgtgttcaccgacgtgcacgaggtcccgcacgtcgcgctggggcagcgggcc
gatctcgtcgtcgtcgcgccggccaccgcggacctgatggcccgcctcgcgcacggccgg
tccgacgacctgctcaccgcgtcactgctcaccgcacgatgtccggtgctgctcgccccg
gccatgcacacggagatgtgggagcaccccgccacccgggacaacgtggccctgctgcgg
tcccggggcaccgtcgtcctggagcccgcgtccggcaggctgaccggtgccgacaccggc
aaggggcggctccccgacccggcggagatcttcgatctcgcccggctgctgctcgagcgc
cccgacgcgctgccccgtgatctcgagggcaggcacgtcgtcgtgagcgccggtggcacc
cgcgagaacctcgatccggtccgctacctgggcaaccggtcgtccgggcggcagggctgg
gccctggcccgggtggcggcccagcgtggcgcgcgggtcaccctcgtcgccgggcacacc
gccgatctcgtcgcgccggccggcgtcgaggtcgtgcccgccgggtccgccggagccatg
gaggccgccgtgcggtcggccgcagccgacgccgacgcggtcgtgatggcggccgccgtc
gccgacttccggccggtcgacaccgccgccgacaagatcaagcgcgggagcgccgagccg
ccgccgctgcgtctggtgcagaaccccgacatcctcgccggcctggtgcacgacaccccg
cggcccggccaggtgatcgtcgggttcgccgccgagaccggcgacgccgacggcgacgtc
ctgcaccacggccgcgcgaagctcgcccgcaagggctgcgacctgctggtggtcaacgcg
gtcggtgaggggaaggccttcgagaccccggacaacgcgggctggctgctcgcccgcgac
ggcggcgaggaggaactcccgatgggctccaaggcgttgctggcctcccgcatctgggac
gcggtcaccccgcgcctggtctga

DBGET integrated database retrieval system