KEGG   Pseudonocardia sp EC080619-01: AD017_27940Help
Entry
AD017_27940       CDS       T04234                                 

Definition
(GenBank) aldehyde dismutase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pecq  Pseudonocardia sp EC080619-01
Pathway
pecq00625  Chloroalkane and chloroalkene degradation
pecq00680  Methane metabolism
pecq01100  Metabolic pathways
pecq01120  Microbial metabolism in diverse environments
pecq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pecq00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    AD017_27940
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AD017_27940
Enzymes [BR:pecq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     AD017_27940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ALL84068
UniProt: A0A0N7K049
Position
6067080..6068294
Genome map
AA seq 404 aa AA seqDB search
MPDNRVVVYKGPGQVAVESIEYPKLELPTDIVDGLKIKRKAPHAAILKIVTTNICGSDQH
MVRGRTTAPVGQSLGHEITGEIVEVGDDVLFVGPGDICSVPFNIACGRCRMCNEGKTGVC
LNVNPARPGAAYGYVDMGGWVGGQAEYVMVPYADFNLLKFPDRDQALEKILDLTMLSDIF
PTGYHGALSAGVTTGSTVYVAGAGPVGLAAAHAAQLLGAAAVVVGDMIPERLQQARSFGC
ETIDLRLDGTLPEHLEQLLGEPEVDAAVDAVGFEARGHGKDADEAPATVLNSVMDITRVG
GALGIPGLYVTGDPGAVDDSAKEGTLGVRIGLGWAKSHQLTTGQCPVKRYNRQLMNAILS
GRAEIAKAVNATTISLDDAPRGYQEFDGGVARKFVIDPHGSVAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacaaccgtgtcgtggtctacaagggaccgggacaggtcgccgtcgagtcgatc
gagtacccgaagctggagcttccgaccgacatcgtcgacggtctcaagatcaagcggaag
gcgccgcacgccgccatcctgaagatcgtcaccaccaacatctgcggctccgaccagcac
atggtccgtggccgcaccaccgcaccggtcgggcagtcgctcggccacgagatcaccggc
gagatcgtcgaggtcggcgacgacgtgctgttcgtcgggcccggggacatctgctcggta
ccgttcaacatcgcctgcgggcggtgccggatgtgcaacgagggcaagaccggtgtctgc
ctgaacgtcaacccggcgcggcccggcgcggcctacggctacgtcgacatgggcggctgg
gtcggtggccaggccgagtacgtcatggtgccctacgcggacttcaacctgctgaaattc
ccggaccgggaccaggcgctggagaagatcctcgacctcacgatgctgtccgacatcttc
ccgaccggctaccacggcgcgctcagtgccggggtgacgaccgggtcgaccgtctatgtc
gcgggcgcgggcccggtcgggctggccgccgcgcacgccgcgcagctgctcggcgcggcc
gcggtcgtcgtcggggacatgatccctgagcgcctgcagcaggcccgcagcttcggctgc
gagacgatcgacctccggctggacgggacgctgcccgagcacctcgaacagctgctcggc
gagcccgaggtggacgccgccgtcgacgccgtcggcttcgaggcgcgtggccacggcaag
gacgccgacgaggcgccggcgaccgtgctgaactcggtcatggacatcacccgggtcggc
ggcgcgctcggcatccccgggctctacgtcaccggggacccgggcgcggtcgacgacagt
gcgaaggagggcaccctcggcgtccggatcggcctgggctgggccaagtcgcaccagctc
accaccggccagtgcccggtgaagcgctacaaccggcagctgatgaacgcgatcctctcc
ggccgggcggagatcgcgaaggcggtcaacgcgacgacgatctccctggacgacgccccg
cgcggctaccaggagttcgacggcggcgtggcccgcaagttcgtcatcgacccgcacggc
tccgtcgcggcctga

DBGET integrated database retrieval system