KEGG   Peptoniphilus sp. ING2-D1G: ING2D1G_1410Help
Entry
ING2D1G_1410      CDS       T03807                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ped  Peptoniphilus sp. ING2-D1G
Pathway
ped00071  Fatty acid degradation
ped00280  Valine, leucine and isoleucine degradation
ped00310  Lysine degradation
ped00362  Benzoate degradation
ped00380  Tryptophan metabolism
ped00620  Pyruvate metabolism
ped00630  Glyoxylate and dicarboxylate metabolism
ped00640  Propanoate metabolism
ped00650  Butanoate metabolism
ped00900  Terpenoid backbone biosynthesis
ped01100  Metabolic pathways
ped01110  Biosynthesis of secondary metabolites
ped01120  Microbial metabolism in diverse environments
ped01130  Biosynthesis of antibiotics
ped01200  Carbon metabolism
ped01212  Fatty acid metabolism
ped02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ped00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ING2D1G_1410 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    ING2D1G_1410 (thlA)
   00640 Propanoate metabolism
    ING2D1G_1410 (thlA)
   00650 Butanoate metabolism
    ING2D1G_1410 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ING2D1G_1410 (thlA)
   00072 Synthesis and degradation of ketone bodies
    ING2D1G_1410 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ING2D1G_1410 (thlA)
   00310 Lysine degradation
    ING2D1G_1410 (thlA)
   00380 Tryptophan metabolism
    ING2D1G_1410 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ING2D1G_1410 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ING2D1G_1410 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ING2D1G_1410 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ped04147]
    ING2D1G_1410 (thlA)
Enzymes [BR:ped01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ING2D1G_1410 (thlA)
Exosome [BR:ped04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ING2D1G_1410 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CDZ75547
UniProt: A0A090HZ53
Position
I:complement(1396047..1397231)
Genome map
AA seq 394 aa AA seqDB search
MEKIVIASAVRTPVGSFGGAFKSVSALQLGVVAAKEAIQRAKVDPAQIDEVLIGNVLQAG
LGQNIARQVMINAGIPKEVPAMTINKVCGSGLRAVSLAAQIIKAGDAEIILAGGTESMSQ
APYLLDKARWGNRMGDGKFIDEMIKDGLWDAFNDYHMGITAENVAEEFDITREAQDHLAT
VSQNRASKARAEGIFAEEIVPVEIKDRKGNVTVVDKDEFIRDGVTEEALAKLRPAFKRDG
GTVTAGNASGINDGAAMVIVMTESKAKELGIEPLATIASYASAGVDPKIMGTGPIPSSRK
ALEKAGLEVKDLDLIEANEAFAAQAGAVAKELEFDMDKVNVNGGAIAIGHPIGASGARIL
TTLLYEMKRRDAKKGLATLCIGGGQGTAMVVTRD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatagttatagctagtgccgttagaacacctgtaggatcttttggcggtgca
tttaagtcagtaagtgctcttcaattaggagttgtagctgctaaagaagcaatacaaaga
gcaaaggttgaccctgcacaaatcgacgaagtattaatcggaaacgtactacaagcagga
cttggtcaaaacatagcaagacaagtgatgattaatgcaggcattcccaaagaagttccg
gcaatgactattaataaagtttgtggttcaggtttaagagctgtttctcttgctgctcaa
ataatcaaagcaggagatgctgaaattattcttgcgggcggtactgaatcaatgtcacaa
gcaccttatcttcttgacaaagcaagatggggaaacagaatgggcgatggcaaattcata
gatgaaatgattaaagacggtctatgggatgcatttaacgattaccatatgggaataact
gcagaaaatgtagctgaagaatttgatatcacaagagaagcacaagatcaccttgctaca
gtttctcaaaacagagcttcaaaggccagagctgaaggcatatttgctgaagaaatcgta
cctgttgaaataaaggacagaaaaggaaatgtcacagtagtcgataaagatgaattcatc
agagacggcgttacagaagaagctcttgcaaaattaagacctgctttcaagagagacggc
ggaacagttacagcaggtaacgcttcaggaattaacgatggagcagctatggttatagtc
atgactgaatcaaaggctaaagaacttggaatcgaacctcttgcaacaatagcttcttac
gcatctgcaggtgttgatcctaaaataatgggcacaggacctattccttcttcaagaaaa
gctcttgaaaaagcagggcttgaagttaaagatttagatctaatcgaagcaaacgaagct
tttgcagcacaagcgggagcagttgcaaaggaacttgaatttgatatggataaagtcaat
gtaaacggaggagcaatagcaatcggtcaccccatcggagccagcggagccagaattcta
actactctactatatgaaatgaagagaagagacgctaaaaagggccttgcaactctatgt
ataggtggaggacaaggaacagctatggtagtgacaagagactaa

DBGET integrated database retrieval system