KEGG   Pelobacter sp. SFB93: A7E78_01765Help
Entry
A7E78_01765       CDS       T04594                                 

Definition
(GenBank) hypothetical protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pef  Pelobacter sp. SFB93
Pathway
pef00520  Amino sugar and nucleotide sugar metabolism
pef01100  Metabolic pathways
pef01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A7E78_01765
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A7E78_01765
Enzymes [BR:pef01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A7E78_01765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: APG26698
UniProt: A0A1L3GLZ2
Position
complement(391964..393103)
Genome map
AA seq 379 aa AA seqDB search
MSIKWRQFLCAALLVFLLDLYFSRPAAVPPPPPLSLQARIGQMLLVCFEGSRLSAQHPLL
QDIRLGHLGGVMLRSQPADEAKGPGNIVSPDQLQALTHSLQSASPTPLLIAVDQEGGKVS
RLKPRDGFPTTTSFAQLGQMNDLAKTRTESEAIAKTLHRYGVNFNFSPVVDLNSNPKNPV
IGFWERSFSTDPAIVTAHAGQVIAAHRSHGIATCLKHFPGHGSSKTDSHRGFVDITETWE
KAELLPFVNLIDAGLADAIMTGHVYNAQLDAKLPATLSRPIITELLREEMKYDGVVISDD
LRMNAIRRHYSFPETIERAINAGVDILLICASDDDLVSDTVALISDLVQQGRVSEQRIDQ
AYRRINRLKSNLATKVTQG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccataaaatggcggcaatttttatgcgcagcacttctggtatttctgctcgacctt
tactttagccgaccggcagcggtccctcctccaccgccgttatccttgcaagcacgcatc
ggccagatgctgttggtctgtttcgaaggttctcggctctctgcgcaacaccctctgctg
caggacattcgtctcggtcacctgggaggcgtcatgctgcgcagccagcctgctgacgaa
gccaaagggccaggcaatatcgtatcccccgatcaattgcaggccctgacccattcgctt
caatcggcgagtcctaccccgctgctcatcgctgttgatcaggaaggagggaaagtgagc
cggctaaagcctcgagatggcttcccaacgacaaccagtttcgcccaactcggccaaatg
aacgatcttgccaaaactcgcacggaatccgaggcgattgccaaaaccttgcatcggtat
ggcgtcaatttcaacttcagcccagtggtcgacctgaacagcaatccgaagaatccggtt
atcggtttttgggagcggtcgttctcaaccgaccctgccatcgtaacggcccacgctggt
caagtcatagcggctcatcgctcccatggcatagcaacctgtctgaaacattttccaggc
cacggcagttcaaaaaccgatagtcatcgaggctttgtcgacatcaccgaaacctgggaa
aaggcagaattgctgccctttgttaatttgattgacgctggcctggcagatgcgatcatg
acagggcatgtttataatgcacagctggatgcaaaactaccggcaaccctgtcccgacct
attataaccgaactgctacgagaagagatgaaatacgacggggtggttatttcggacgat
ctgcggatgaatgcgatcaggcggcactattcttttccggagacgatagaacgtgccatc
aatgctggagtggacatcttattaatttgcgccagcgatgatgaccttgtcagcgatacc
gtagccctgatttccgacctggtacaacagggtcgcgtcagcgaacagcgaatcgatcaa
gcttatcgccgcatcaatcgtctgaagtcaaatctggcaaccaaagtgacacagggttaa

DBGET integrated database retrieval system