KEGG   Pelobacter sp. SFB93: A7E78_01880Help
Entry
A7E78_01880       CDS       T04594                                 

Definition
(GenBank) bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
pef  Pelobacter sp. SFB93
Pathway
pef00740  Riboflavin metabolism
pef00790  Folate biosynthesis
pef01100  Metabolic pathways
pef01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pef00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    A7E78_01880
   00790 Folate biosynthesis
    A7E78_01880
Enzymes [BR:pef01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     A7E78_01880
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     A7E78_01880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: APG26718
UniProt: A0A1L3GM09
Position
412901..414106
Genome map
AA seq 401 aa AA seqDB search
MPIQNIEAALEDIRQGKMVILVDDEDRENEGDLVIAAELVTPEAVNFMAKEGRGLICLSL
TEERADELDLPLMVQENSSSFGTAFTVSIEARRGVSTGISAKDRATTIQVAIADESQAKD
LARPGHVFPLRAKKGGVLVRAGQTEGSVDLARLAGLKPAGVICEIMNDDGSMARMPQLKK
FAKKHDLKIVTVADLVSYRMRKELLVRRAADTIIPTPFGGDFQAIAYENEVDDLQHLALV
KGTIDPEKPVMVRVHSECLTGDVFGSLRCDCGDQLHSAMCQIADDGCGVIVYMRQEGRGI
GLINKLKAYALQDDGHDTVEANVALGFQDDLRDYGIGAQILLDLGVRKIRLMTNNPKKIV
GLEGYGLNVVERVPIEISPTCENLRYLKTKREKMGHLLENL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgccgattcaaaatattgaagcggccctggaagatatccgccagggcaaaatggttata
ttggtcgatgatgaggatcgagaaaatgaaggcgatctggtcatcgcagctgaactggtc
acacccgaggccgttaatttcatggctaaggaagggcgaggtttaatctgcttatccctc
accgaagagcgggccgacgagttggacctgcccctgatggtacaggaaaacagttcgtct
ttcgggacagcttttaccgtttccatcgaagcccgccgtggtgtttcgacgggcatttcc
gccaaggatcgagcgaccacgattcaggttgcaattgccgatgaatcgcaggctaaagac
ctggccagacccggtcatgtttttcctttaagggccaaaaaaggtggtgttcttgtacgc
gccgggcagactgagggctcggtcgatctggcgagactggcgggacttaaaccggctggt
gttatctgcgagatcatgaacgatgacggcagcatggctcgcatgccgcaactgaaaaag
tttgccaagaaacacgacctcaaaatcgttactgtagcagaccttgtcagctatcgtatg
cgcaaagagctgttggttcggcgagctgccgacaccattattccgaccccctttggtggt
gactttcaggccatcgcttacgaaaatgaggtcgatgatttacagcacctggccctggtt
aaaggtaccattgatccggaaaagccggtgatggttcgggttcattcagaatgcctgacc
ggagacgtattcggttccttgcgttgtgattgcggtgaccaattgcactcggccatgtgt
caaatcgccgatgacggctgtggcgttatcgtctacatgcgccaggaaggacggggcatc
ggtctgatcaataaacttaaagcctatgccttgcaggacgatggtcatgatacggtagag
gccaatgtggcactcggctttcaagatgatcttcgagactacggtatcggcgcgcagatt
ctactggatctcggcgtgcggaaaattcgactcatgaccaataatcccaaaaagatcgtc
ggtctagaaggatatggtctcaatgtcgtcgaaagagtaccgatcgagatatcaccgacc
tgcgaaaaccttcgctatctcaaaactaaacgggaaaaaatggggcacctgctagaaaac
ctctag

DBGET integrated database retrieval system