KEGG   Pelobacter sp. SFB93: A7E78_06395Help
Entry
A7E78_06395       CDS       T04594                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pef  Pelobacter sp. SFB93
Pathway
pef00071  Fatty acid degradation
pef00280  Valine, leucine and isoleucine degradation
pef00310  Lysine degradation
pef00362  Benzoate degradation
pef00380  Tryptophan metabolism
pef00620  Pyruvate metabolism
pef00630  Glyoxylate and dicarboxylate metabolism
pef00640  Propanoate metabolism
pef00650  Butanoate metabolism
pef00900  Terpenoid backbone biosynthesis
pef01100  Metabolic pathways
pef01110  Biosynthesis of secondary metabolites
pef01120  Microbial metabolism in diverse environments
pef01130  Biosynthesis of antibiotics
pef01200  Carbon metabolism
pef01212  Fatty acid metabolism
pef02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A7E78_06395
   00630 Glyoxylate and dicarboxylate metabolism
    A7E78_06395
   00640 Propanoate metabolism
    A7E78_06395
   00650 Butanoate metabolism
    A7E78_06395
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A7E78_06395
   00072 Synthesis and degradation of ketone bodies
    A7E78_06395
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A7E78_06395
   00310 Lysine degradation
    A7E78_06395
   00380 Tryptophan metabolism
    A7E78_06395
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7E78_06395
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A7E78_06395
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7E78_06395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pef04147]
    A7E78_06395
Enzymes [BR:pef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A7E78_06395
Exosome [BR:pef04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7E78_06395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: APG27504
UniProt: A0A1L3GNK2
Position
complement(1413377..1414558)
Genome map
AA seq 393 aa AA seqDB search
MSEKIVVLSAVRTAIGKFGGTLQNVPAPRLGAAVIEKALEKAGVRGSMVDEVIMGNVLSA
GLGQNPARQASILAGLPAEIGAVTVNMVCGSGLKAVMLAAQAIKAGAANLVVAGGMENMS
AAPHLLHGLRRGIKAGNAPLVDAMLHDGLLDAFHNVQMGETAERTAEKYGLTRKEADVFA
QRSQHLAAKAQQERNFDREIVPVLLDGVTFASDECVRADTTLEGLAGLSPVFRENGRLTP
GNSSQLADGAAALVVASASRARELNLVPLAHITHYTTAGVSPVEVMEAPIPAVRKLLVKA
GISLADIDLVEHNEAFSVASLAVLRELGIDLQKFNVRGGAVALGHPIGASGARILVSLLH
ALQDQNLKRGLATLCMGGGNGLAMLVEREKPTI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaagatagttgttcttagcgcggttcgtaccgctatcggcaaattcggcgga
acgcttcagaacgttcccgctccgcgcctcggtgcggcagtcattgaaaaggccctggag
aaagccggtgttcggggttcgatggtggatgaggtcatcatgggcaacgttctttcagcc
ggacttgggcaaaatcccgcccggcaagcgtccatcctggccggtctccccgcagagatc
ggggcggtgacggtcaacatggtttgcggatccggcctgaaggcggtgatgttggcggct
caagcgataaaggccggcgcagcgaaccttgttgtggcaggtggtatggagaacatgagt
gctgcaccccatttgttgcatggtctgcgccgggggatcaaagccggtaacgcccccctg
gtggacgccatgctgcacgatgggttgctcgatgctttccacaatgtccagatgggagag
accgcggagagaacggccgagaaatacgggctgacccggaaggaggcggatgtctttgcc
caacgcagccagcacttggcggccaaggcacaacaggaaaggaattttgaccgggagatc
gtgccggtattgctcgacggcgtcactttcgccagcgacgaatgcgtaagggccgacacc
accctggaaggcttggccggcctgtctcccgtttttcgggaaaacgggagactgaccccc
ggcaacagttctcagcttgctgatggcgcagcggccctggtggtggcttcggcttcccgg
gcaagggaattgaacctcgtgcctctggcccatatcacccactacacaacggccggggtg
tctccggtggaagtgatggaagcgccgatcccggctgtcagaaagctgctggttaaagct
ggcatatccctggccgatatcgacctggtggaacataatgaagcattttccgttgcctcc
ctggccgtgctccgggaactgggcatcgatctgcagaagtttaatgtacgtggcggtgcg
gtggctttggggcatcccatcggtgccagcggtgccaggatcctagtgtctctactgcat
gccctgcaggaccaaaatttaaagaggggtcttgcaaccctgtgcatgggcggcggcaac
ggtctggccatgcttgtcgaacgggaaaagccaacaatatga

DBGET integrated database retrieval system