KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00481Help
Entry
SAR11G3_00481     CDS       T01465                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
pel00020  Citrate cycle (TCA cycle)
pel00310  Lysine degradation
pel00380  Tryptophan metabolism
pel01100  Metabolic pathways
pel01110  Biosynthesis of secondary metabolites
pel01120  Microbial metabolism in diverse environments
pel01130  Biosynthesis of antibiotics
pel01200  Carbon metabolism
Module
pel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR11G3_00481
  09105 Amino acid metabolism
   00310 Lysine degradation
    SAR11G3_00481
   00380 Tryptophan metabolism
    SAR11G3_00481
Enzymes [BR:pel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SAR11G3_00481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEA80956
UniProt: F2I3I8
Position
433979..435184
Genome map
AA seq 401 aa AA seqDB search
MADKITVPTLGESLTEATVAKWLKKVGDSVQEDEEIVSLETDKVSIDVTAPKSGILSEIV
AKDGATVEVGAHLGSIDASASPAKKKEVQQDKQETTVVEIKKEENILEKKIDNQNKKKEL
SPSVKRIINEKNINIESVDGTGKDGRILKGDLIGLMGFSPAPNTKKIEIGEEERVKMTRL
RSTIAKRLKEAQNNAAILTTFNEIDMSMIIQIRKDNKDEFEKRYGTKLGFMSFFVKACVN
ALQTYPSVNAEVQGEEIVYKNYYNIGVAVGTEKGLVVPVLGNADELSFAEIEKEIITLGT
KAKNNQLSIEELQGGTFTITNGGIYGSMLSTPIINPPQSGVLGMHNIVQRAVVINGKIEI
RPIMYLALSYDHRIIDGKEAVSFLVRVKEILEDPRRLFLNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaaattactgtaccaacactaggagaatctttaactgaagcaactgttgca
aagtggttgaaaaaagtaggtgatagtgttcaagaagatgaagagattgtttccttagaa
actgacaaggtaagtattgatgttacggctccaaaatctggaattttgtcggaaattgtt
gctaaagatggagctacagttgaggtaggagcacaccttggctctatagatgcttcagcc
tcacctgccaaaaagaaagaagtgcagcaagataaacaagaaacaacagtggttgagatt
aaaaaagaagaaaatattttagagaaaaaaatagataatcaaaacaaaaagaaagaattg
tctccatctgtaaaacgtataattaatgaaaaaaatattaatatagaaagtgttgatggg
acaggaaaagatggaagaattttaaaaggtgatttgataggacttatgggatttagtcct
gcacccaacacaaaaaaaattgaaatcggagaagaggaaagagttaaaatgactcgtctt
aggtcgacaatcgcaaaaagattgaaagaagctcagaataacgcagcaattttaactacc
tttaatgaaattgacatgtccatgatcattcaaattagaaaagataacaaagatgagttt
gaaaaaagatatggaactaaacttggctttatgtctttttttgtaaaagcgtgcgttaat
gctttgcaaacgtatccttctgtaaatgccgaagttcagggagaagaaattgtttataaa
aactattataatattggagttgcagtagggacagagaagggtttggtcgtacctgttctg
ggaaatgcagatgaactttcatttgccgaaattgaaaaagagattatcactcttggaaca
aaagctaaaaacaaccaattatctattgaagaattgcagggtggaacatttacaatcaca
aatggaggtatatatggatctatgctttctactccaataattaatcctcctcaatctggg
gttttgggtatgcacaatatcgttcaaagggctgtggtaataaatggaaaaattgaaatt
agacccattatgtatcttgctctttcatacgatcatagaattatcgatggtaaagaggcg
gtgtcttttttagtaagagtaaaagaaatattagaagatcctagaagattatttttaaac
ttataa

DBGET integrated database retrieval system