KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00684Help
Entry
SAR11G3_00684     CDS       T01465                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
pel00260  Glycine, serine and threonine metabolism
pel00750  Vitamin B6 metabolism
pel01100  Metabolic pathways
pel01110  Biosynthesis of secondary metabolites
pel01120  Microbial metabolism in diverse environments
pel01230  Biosynthesis of amino acids
Module
pel_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11G3_00684
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAR11G3_00684
Enzymes [BR:pel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAR11G3_00684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEA81159
UniProt: F2I0F4
Position
605155..606558
Genome map
AA seq 467 aa AA seqDB search
MLYFSTRDKQRTFSFKEVFLNALASDGGLYVPTSIPKFSPEKIQSMKNYTFQEMSYEIFN
VFVGDAFSPEELKGIISKSYSVFRNEKIVDLKLIDNISCVELFHGPTLAFKDIAMQVLGN
MYENLLNKSKNKMNLITATSGDTGAAAIDALKSKKYLNIFVLHPENKISETQRRLMTTVL
DKNVYNIAIKGTFDDCQYLVKEMFNDQKFRSNIQMSGVNSINWARIVAQIVYYFFIYLSQ
KETEKRMVVSVPTGNFGDIYAGYIAKQMGLPIEKLIIASNHNNLLEKCLSTGLYQPSKVN
PSVSPSMDIQVASNFERILFEICNQDESRVVALMKNLKNKKEFQLNKTELSNLQENFLAH
SVSEEETLQTIKQVYQEHNSVLDPHSAIGFKALKKLSSLSNNFSYFCFETAHPCKFPDAI
VSAIGKEPPMPDFVKKIFSKEESFVVLDGNLEILKSYIEKKVSNNSS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctgtattttagtacaagagacaaacaaagaactttttcattcaaagaagtgttcctt
aatgctttggcgtcagatggtggtctttatgtaccaacaagtattcctaaattcagtcca
gaaaaaattcaatcaatgaaaaattatacatttcaagaaatgtcgtacgaaattttcaat
gtatttgttggagatgccttttccccagaggaacttaaaggcattatcagtaaatcatat
tcagttttcagaaacgaaaaaattgttgatctaaaattaatagataatatttcttgtgta
gaactctttcatggaccaactctcgcattcaaagatatcgcaatgcaagtgctaggtaat
atgtatgagaatctattgaataaaagtaaaaataaaatgaacttaattacagccacttct
ggtgatacaggagctgcagctattgatgccctgaaaagtaaaaaatatttaaatattttt
gttttgcatcctgaaaataagatttcagaaacacaaagaagacttatgacgacagtgcta
gacaagaatgtctacaatattgcaattaaaggaacatttgatgattgccagtatttggtc
aaagaaatgtttaatgatcaaaaatttagaagcaatattcagatgtctggagttaattca
attaactgggcaaggatagtagctcaaatagtttattatttttttatttatttaagtcag
aaagaaacagaaaagagaatggtagtttctgttcctacaggaaactttggtgatatttat
gcagggtatattgccaaacaaatggggcttcctatagaaaagttaatcatagcaagtaat
cataacaacttattagaaaagtgtttaagtacaggattgtatcaaccttccaaagtgaac
ccctccgtttcacctagtatggacattcaagtggcgagcaattttgaaagaatattattt
gaaatatgcaatcaagatgaatctagagtagtagctctgatgaaaaacttaaaaaataaa
aaagaatttcaattgaataaaactgaactttctaaccttcaggaaaattttttagcgcac
agtgtatctgaagaagaaacattacaaacaattaaacaggtttatcaagaacacaattct
gttttagatccacattcagccatcggatttaaagcattaaaaaagttaagtagtttatct
aataatttttcatatttttgctttgaaacagcccatccttgcaaatttcctgatgcaatc
gtgagtgctataggcaaggaaccacccatgccagattttgtgaaaaaaatattttcaaaa
gaagagagttttgtagtcttggacggtaatttagaaatattaaaaagttatatagaaaaa
aaagttagcaacaactctagctga

DBGET integrated database retrieval system