KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00833Help
Entry
SAR11G3_00833     CDS       T01465                                 

Definition
(GenBank) HAD superfamily hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
pel00361  Chlorocyclohexane and chlorobenzene degradation
pel00625  Chloroalkane and chloroalkene degradation
pel01100  Metabolic pathways
pel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pel00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAR11G3_00833
   00361 Chlorocyclohexane and chlorobenzene degradation
    SAR11G3_00833
Enzymes [BR:pel01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SAR11G3_00833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AEA81308
UniProt: F2I2C2
Position
complement(745170..745775)
Genome map
AA seq 201 aa AA seqDB search
MAIQKVIFDVGQVLVKFNPQNLFIKILKDEEKVDFFLKNICTWEWHIQQDLIYDTSKAAG
PVIKKYPEYKEAIEAFYGRFLEMIDSVHQENVNLALKLKQKGYPIYLLSNFPGDQFEKYR
LQNSFLNEFDDRIISGDVGLAKPDIKIYQLAIKKFNLNPEESLFIDDKIENTKAAEQAGI
KTIQLQNPEDLDKEIRKFIDL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaatccaaaaagttatttttgatgtcgggcaggtattagtaaaattcaatcctcaa
aatctatttattaaaattcttaaagatgaagaaaaagtagatttttttttaaaaaatatt
tgtacttgggagtggcatattcaacaagatttaatttatgatacctccaaagcagcaggg
ccagtgataaaaaaatatccagaatacaaagaagcgatagaagctttttatggtagattt
ctagagatgattgatagcgttcatcaagaaaatgtaaatctagctttaaaacttaagcaa
aaaggctatccaatctatttgcttagcaattttccaggagatcagtttgaaaaatataga
ttgcaaaatagttttctaaatgagtttgatgacagaattatttcgggtgatgttggatta
gccaagccagatattaaaatttatcagctggcgataaaaaaatttaatctcaaccctgaa
gaatctttatttattgatgataagattgaaaataccaaagctgctgaacaagcaggaata
aaaaccattcaactacaaaatccagaagatttagataaagaaataagaaaatttattgat
ttataa

DBGET integrated database retrieval system