KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00889Help
Entry
SAR11G3_00889     CDS       T01465                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
pel00071  Fatty acid degradation
pel00072  Synthesis and degradation of ketone bodies
pel00280  Valine, leucine and isoleucine degradation
pel00310  Lysine degradation
pel00362  Benzoate degradation
pel00380  Tryptophan metabolism
pel00620  Pyruvate metabolism
pel00630  Glyoxylate and dicarboxylate metabolism
pel00640  Propanoate metabolism
pel00650  Butanoate metabolism
pel00900  Terpenoid backbone biosynthesis
pel01100  Metabolic pathways
pel01110  Biosynthesis of secondary metabolites
pel01120  Microbial metabolism in diverse environments
pel01130  Biosynthesis of antibiotics
pel01200  Carbon metabolism
pel01212  Fatty acid metabolism
pel02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAR11G3_00889
   00630 Glyoxylate and dicarboxylate metabolism
    SAR11G3_00889
   00640 Propanoate metabolism
    SAR11G3_00889
   00650 Butanoate metabolism
    SAR11G3_00889
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAR11G3_00889
   00072 Synthesis and degradation of ketone bodies
    SAR11G3_00889
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAR11G3_00889
   00310 Lysine degradation
    SAR11G3_00889
   00380 Tryptophan metabolism
    SAR11G3_00889
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAR11G3_00889
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAR11G3_00889
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAR11G3_00889
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pel04147]
    SAR11G3_00889
Enzymes [BR:pel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAR11G3_00889
Exosome [BR:pel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAR11G3_00889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEA81364
UniProt: F2I0S9
Position
789881..791071
Genome map
AA seq 396 aa AA seqDB search
MKNTNIVITSAFRTAIGSFGGALAHQAASHLGSLVIKRCLEHSELKSDEVDMVYMGQVLT
TGAGQNPARQAAIHAGISKEKTATTINQVCGSGLASVALAYNSIKCEDGTIMIAGGQESM
SNSPHYIHVRDGIKMGDGKIKDSMVMDGLWDIYNQYHMGITAENVSEQFNISRKQQDEFA
ALSQKKTHNAIVARKFKDEIVPVILKVKKQETVFEQDEHPKIGSTVEKLGTLRPAFKENG
SVTAGNASGLNDGAAAVVLMTEETAKKKNLKPLARIVSWAQCGVDPSIMGTGPIPASNLA
LKKAGWSKDDLDLIETNEAFAAQAIAVNNELGFDLEKVNVNGGAIALGHPIGASGARILV
TLIHEMQKRKAKKGLATLCIGGGMGIAMCIENNFSD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacaaacatagtaataacaagtgcttttagaacagccattggatcttttggt
ggagcacttgcacaccaggcagcctcacacttgggctccttagttatcaagaggtgtcta
gagcattctgagcttaagtctgacgaagttgatatggtttatatggggcaggttcttacc
acaggggcaggtcaaaacccagcaaggcaggcagctatacatgcgggtatatcaaaagaa
aaaacagcaactacaattaaccaagtctgcggatcgggtctagcttctgtagctttagcc
tataattcaattaaatgtgaagatggaactattatgattgcgggtggacaagaaagcatg
tccaactcccctcattatatacatgtacgtgacggaattaaaatgggagatggaaaaata
aaagattctatggtcatggatggattatgggacatttataatcagtatcacatgggcatt
acagctgaaaatgtttctgaacaatttaatatttcaagaaagcagcaagatgaatttgca
gctttgtcgcaaaaaaaaactcataacgcaattgttgctagaaagtttaaagatgaaatt
gttccagtaatactcaaagttaaaaaacaagaaactgtttttgaacaagacgaacatcca
aagataggatctacagttgaaaagcttggaactttaagaccagcctttaaagaaaacggt
tcagttaccgctggtaatgcgtctggtttgaatgatggtgcagcagcagtagtattaatg
acagaagaaactgctaagaaaaaaaatctaaaacccctggctcgaatagtttcgtgggct
caatgtggagtagatccttctataatgggaacaggacctattcccgcttctaatttggct
ttaaaaaaagcaggatggagtaaagacgatttagacttaattgaaactaacgaggctttt
gcagcacaagctattgcagtaaataacgaattgggttttgatcttgagaaagttaatgtt
aacggaggagcgattgcattaggccatcctatcggggcttctggagcaagaattttagtt
accctaattcacgaaatgcaaaaaagaaaagctaaaaaaggattagcaaccttatgcatt
ggtggtggtatgggtattgccatgtgtattgaaaataatttttctgattaa

DBGET integrated database retrieval system