KEGG   Pseudomonas entomophila: PSEEN0523
Entry
PSEEN0523         CDS       T00362                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
pen  Pseudomonas entomophila
Pathway
pen02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pen00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSEEN0523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pen02044]
    PSEEN0523
Secretion system [BR:pen02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSEEN0523
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAK13469
UniProt: Q1IFT3
Position
539135..539635
AA seq 166 aa
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTLRADDRKIEDRKPISIDKM
NFDEVLAKQELSMTLAVPNRLQEGAEGDELAVSLRVNTMKDFNPASLVEQVPELKKLMEL
REALVALKGPLGNAPAFRKAIEGVLADGESRERVLGELGLNAAPDA
NT seq 501 nt   +upstreamnt  +downstreamnt
atggccaaagaaggctcggtagcccccaaggaacgcatcaacgtcacgttcaaacccgcc
accggtggggctcaggaagagatcgaactgccgttgaaactactggcgatcggtgactac
accctgcgtgccgacgatcgcaagatcgaagaccgcaagccgatcagcatcgacaagatg
aacttcgacgaggtgctggccaagcaggaactgagcatgaccctggccgtgcccaaccgc
ctgcaggaaggtgccgaaggcgacgagctggcggtcagcctgcgcgtcaacaccatgaag
gacttcaacccggccagcctggtcgagcaagtgccggagctgaagaagctgatggaactg
cgtgaagccctggttgccctgaaaggcccgctgggcaacgccccggcgttccgcaaggcc
atcgaaggcgtgctggccgacggcgagtcccgcgagcgcgtgctcggtgagctgggcctg
aacgccgcgcctgacgcctga

DBGET integrated database retrieval system