KEGG   Pseudomonas entomophila: PSEEN1293Help
Entry
PSEEN1293         CDS       T00362                                 

Gene name
hepA
Definition
(GenBank) RNA polymerase-associated protein HepA
  KO
K03580  ATP-dependent helicase HepA [EC:3.6.4.-]
Organism
pen  Pseudomonas entomophila
Brite
KEGG Orthology (KO) [BR:pen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pen03021]
    PSEEN1293 (hepA)
Enzymes [BR:pen01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     PSEEN1293 (hepA)
Transcription machinery [BR:pen03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     PSEEN1293 (hepA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RapA_C Tudor_RapA Tudor_1_RapA Helicase_C SNF2_N ResIII DEAD
Motif
Other DBs
NCBI-ProteinID: CAK14184
UniProt: Q1IDS5
Position
complement(1356152..1358998)
Genome map
AA seq 948 aa AA seqDB search
MAQQYQPGQRWISDSEAELGLGTILAQDGRLLTVLYPATGDTRQYSLRNAPLTRVRFSPG
DQITHFEGWKLTVREVEDVDGLLVYHGIDGQNQPHTLPETQLSNFIQFRLASDRLFAGQI
DPLSWFSLRYNTLQHNSKQMLSSLWGLGGVRAQPIAHQLHIAREVADRIAPRVLLADEVG
LGKTIEAGLVIHRQLLSGRASRVLILVPENLQHQWLVEMRRRFNLQVALFDAERFIESDA
SNPFEDAQLALVALEWLVDDEKAQDALFAAGWDLMVVDEAHHLVWHEEQASPEYALVEQL
AQVIPGVLLLTATPEQLGQDSHFARLRLLDPNRFHDLAAFRAESENYRPVAEAVQELLDE
GRLSAKAHATIQGFLGAEGEALLAAVSDGDSQASARLIRELLDRHGTGRVLFRNTRAAIQ
GFPERQLHPYPLANPEQYAELPSGERAELYPEVAFQAQGETSDEERWWRFDPRVDWLIDT
LKMLKRTKVLVICAHAETAMDLEDALRVRSGIPATVFHEGMSILERDRAAAYFADEEFGA
QVLICSEIGSEGRNFQFAHHLVMFDLPAHPDLLEQRIGRLDRIGQKHTIQLHIPYLQNSP
QERLFQWYHEGLNAFLNTCPTGNALQHQFGPRLLPLLAEGDEKAWGKLVAEARTERENLE
AELHSGRDRLLELNSGGAGEGQALVEAILEQDDQFALPIYMETLFDAFGIDSEDHSENAL
VLKPSEKMLDASFPLGDDEGVTITYDRGQALSREDMQFLTWEHPMVQGGMDLVLSGSMGN
TAVALIKNKALKPGTVLLELLYVSEVVAPRSLQLGRYLPPAALRCLLDANGNDLAARVAF
ETLNDQLESVPRASSNKFVQAQRDVLAKRIAAGEAKVLPTHEERVAQAQQRLAAEADEEL
ARLTALKAVNPTVRDSEIDALRKQREDGMAALEKAALRLEAIRVLVAG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcagtatcaaccggggcaacgctggatcagcgacagcgaagccgagctcggt
cttgggaccatcctggcgcaggatggccgccttctgaccgtgctctacccggccacgggc
gacacccgccagtactcgctacgcaatgcgccgctgacccgcgtgcgcttctcgcctggc
gaccagatcacccacttcgagggctggaagctgaccgtgcgcgaggtcgaggacgtcgat
ggcctgctggtctaccacggcatcgacgggcagaaccagccacacacgttgcccgagacg
cagctgtcgaacttcatccagttccgcctggccagcgaccgcctgttcgccgggcagatc
gacccgctgtcgtggttctcgctgcgctacaacaccttgcaacacaacagcaagcagatg
ctctcttcgctgtggggcctcggtggcgtgcgtgcgcaacccatcgcccaccagttgcac
atcgcccgtgaagtcgccgaccgcatcgccccgcgcgtgttgctggcagacgaagtgggt
ctgggcaagaccatcgaagccggcctggtgatccaccgccagctgctgtccggccgtgcc
agccgcgtgctgatcctggtgcccgagaacctccagcaccagtggctggtggagatgcgc
cgacgcttcaacctgcaggtggcgctgttcgacgccgagcgcttcatcgaaagcgacgcc
agcaacccgttcgaggatgcccagctggcgctggtggccctggagtggctggtcgacgac
gaaaaggcccaggacgcgctgttcgccgccggctgggacctgatggtggtcgacgaggcc
caccacctggtctggcacgaagaacaggccagccccgagtacgcactggtcgagcaactg
gcccaggtcatcccgggcgtgctgctgctcaccgcgacgcctgaacagctcggtcaggac
agccacttcgcccgcctgcgcctgctcgaccccaaccgtttccacgacctggccgcattc
cgcgccgaaagcgaaaactatcgcccggtggccgaagcggtacaggaactgctcgacgaa
ggccgcctgtcggccaaggcccacgcgaccatccaaggcttccttggcgccgaaggcgaa
gcgctgctggccgcggtcagcgatggcgacagccaggccagcgcgcgcctgatccgcgag
ctgctcgaccgccacggcaccggccgcgtgttgttccgcaacacccgggcggcaatccag
ggcttccccgagcgccagctgcacccctacccgctggccaaccccgagcaatacgccgaa
ctgccgtcgggcgagcgcgccgagctgtacccagaggtcgctttccaggcccagggcgag
accagcgacgaagaacgctggtggcgcttcgacccacgggtcgactggctgatcgacacc
ctgaagatgctcaagcgcaccaaggtgctggtgatctgcgcccacgccgagaccgccatg
gacctggaagacgccctgcgcgtgcgctccggtattccagccaccgtgttccacgaaggc
atgagcatcctcgagcgcgaccgcgccgccgcctacttcgccgacgaagagttcggcgcc
caggtactgatctgctccgaaatcggcagtgaaggccgcaacttccagttcgcccatcac
ctggtgatgttcgacctgccggcccacccggatttgctcgaacagcgcatcggccgtctc
gaccggatcggccagaaacatacgatccagctgcacatcccgtacctgcagaacagcccg
caggaacgcctgtttcagtggtaccacgaaggcctcaacgccttcctcaacacctgcccg
accggcaacgccctgcagcaccagttcggcccgcgtctgctgccgctgctcgccgaaggt
gacgagaaagcctggggcaagctggtggctgaagcccgcacagaacgtgaaaatctcgaa
gccgagctgcacagtggccgcgaccgcctgctggagctcaactccggtggcgccggcgaa
ggtcaggcactggtcgaggcgatcctcgagcaggacgaccagttcgccctgccgatctac
atggaaaccctgttcgacgccttcggcatcgacagcgaagaccattccgagaacgccctg
gtgctaaagcccagtgaaaagatgctcgatgccagcttcccgctgggtgacgacgaaggt
gtgaccatcacctacgaccgtggccaggcgctatcgcgcgaagacatgcaattcctcacc
tgggaacacccgatggttcagggcggcatggacctggtgctgtccggctcgatgggcaac
accgcggtcgcgctgatcaagaacaaggcactcaagcccggcaccgtgctgctcgagttg
ctatatgtcagcgaggtggtagcgccgcgcagcctgcagctgggccgctacctgccaccg
gcggcgctgcgttgcctgctcgatgccaacggcaacgacctggcggcacgcgtggccttc
gaaacgctcaacgaccagctcgagagcgtgccacgggccagttccaacaagttcgtccag
gcccagcgcgatgtgctggccaagcgcatcgccgcaggcgaggccaaggtcctgccaacg
cacgaggagcgcgtcgcccaggcccagcaacgcctggcggccgaggcggatgaagagttg
gcgcgcctgaccgcgctcaaggcggtcaaccccaccgtgcgcgacagcgaaatcgacgcc
ctgcgcaagcagcgcgaggatggcatggcggcgctggagaaagccgcactgcgcctggaa
gccatccgggtgctggtggcgggctga

DBGET integrated database retrieval system