KEGG   Pseudomonas entomophila: PSEEN1584Help
Entry
PSEEN1584         CDS       T00362                                 

Gene name
msrB
Definition
(GenBank) peptide methionine sulfoxide reductase
  KO
K07305  peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
pen  Pseudomonas entomophila
Brite
KEGG Orthology (KO) [BR:pen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSEEN1584 (msrB)
Enzymes [BR:pen01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.12  peptide-methionine (R)-S-oxide reductase
     PSEEN1584 (msrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SelR Yippee-Mis18
Motif
Other DBs
NCBI-ProteinID: CAK14445
UniProt: Q1ID16
Position
1654260..1654655
Genome map
AA seq 131 aa AA seqDB search
MQKIDKTLEEWRAMLDPAQYQVCRLKGTERPFSGKYNSERRDGVYHCICCDLPLFDSKAK
FDSGCGWPSFYEPIEEAAMIEIRDTSHGMIRTEVTCAQCDAHLGHVFPDGPPPTGLRYCI
NSVCLDLKPRD
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagatcgacaagacactggaagagtggcgcgccatgctcgaccccgcccagtac
caggtgtgccgcctgaagggcaccgagcggccgttcagcggcaagtacaacagtgaacgc
cgcgatggcgtctaccattgcatctgctgcgacctgccgctgttcgactcgaaggccaag
ttcgactccggttgcggttggccgagcttctacgaacccatcgaggaggccgcgatgatc
gagatccgcgacacctcccacggcatgatccgcaccgaagtcacctgcgcgcaatgcgat
gcccacctgggccacgtattccccgacggcccgccaccgaccggcctgcgctactgcatc
aactcggtatgcctggacctcaaaccccgcgattga

DBGET integrated database retrieval system