KEGG   Pseudomonas entomophila: PSEEN1855Help
Entry
PSEEN1855         CDS       T00362                                 

Definition
(GenBank) putative amino acid ABC transporter, ATP-binding protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
pen  Pseudomonas entomophila
Pathway
pen02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pen00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PSEEN1855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pen02000]
    PSEEN1855
Enzymes [BR:pen01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     PSEEN1855
Transporters [BR:pen02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    PSEEN1855
   Histidine transporter
    PSEEN1855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_15 AAA_13 AAA_23 AAA_16 G-alpha AAA_33 AAA_25 AAA_22 RsgA_GTPase PRK
Motif
Other DBs
NCBI-ProteinID: CAK14694
UniProt: Q1ICB9
Position
complement(1945865..1946668)
Genome map
AA seq 267 aa AA seqDB search
MPLNTFEQAPAARAHAGAIKLSVEGLHKHYGEHQVLKGVSLQARKGDVISLIGASGSGKS
TFLRCINFLEQPDAGSITLDGQTLEIHPGTRTPPPAQLQNLRTRLAMVFQHFNLWSHLTV
LENICLAPRKVLGVSASEAEARARKYLDKVGLPARAAEQYPAFLSGGQQQRVAIARALAM
EPEIILFDEPTSALDPELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGL
VEEHGSAEILDRPQSERLRQFLSNRLK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttgccactcaataccttcgaacaggcccccgcagcgcgcgcccacgccggcgccatcaag
ctcagcgtcgagggcctgcacaagcactatggcgaacaccaggtgctcaagggcgtctcg
ctacaggcgcgcaaaggcgacgtgatcagcctgatcggcgccagcggctcgggcaagagc
accttcttgcgctgcatcaacttcctcgaacaacccgacgccggcagcatcaccctggac
ggccaaaccctggaaattcaccccggtacccgcaccccgccaccggcccagttgcagaac
ctgcgcacgcgcctggccatggtgttccaacacttcaacctgtggagccacctcacggtg
ctggagaacatctgcctggcgccgcgcaaggtgctgggcgtcagcgccagcgaagccgaa
gcccgtgcccgcaaatacctggacaaggtcggcctgccggcgcgcgccgccgagcagtac
ccggcgttcctctctggtggtcagcaacaacgcgtggccattgcccgggcgctggccatg
gaaccggagatcatcctcttcgacgagcccacctcggccctggaccctgagctggtcggc
gaagtgctcaaggtgatacagacgctcgccgaggaaggacgtaccatgctcatggtcacc
catgaaatggggttcgcccgccaggtgtcgagccaggtgctgttcctgcaccagggcctg
gtcgaagagcacggcagcgccgagatcctcgaccggccacagagcgagcgcctgcggcag
ttcctctccaaccgcctcaagtga

DBGET integrated database retrieval system