KEGG   Pseudomonas entomophila: PSEEN2795Help
Entry
PSEEN2795         CDS       T00362                                 

Gene name
pcaF-2
Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pen  Pseudomonas entomophila
Pathway
pen00071  Fatty acid degradation
pen00072  Synthesis and degradation of ketone bodies
pen00280  Valine, leucine and isoleucine degradation
pen00310  Lysine degradation
pen00362  Benzoate degradation
pen00380  Tryptophan metabolism
pen00620  Pyruvate metabolism
pen00630  Glyoxylate and dicarboxylate metabolism
pen00640  Propanoate metabolism
pen00650  Butanoate metabolism
pen00900  Terpenoid backbone biosynthesis
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01130  Biosynthesis of antibiotics
pen01200  Carbon metabolism
pen01212  Fatty acid metabolism
pen02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSEEN2795 (pcaF-2)
   00630 Glyoxylate and dicarboxylate metabolism
    PSEEN2795 (pcaF-2)
   00640 Propanoate metabolism
    PSEEN2795 (pcaF-2)
   00650 Butanoate metabolism
    PSEEN2795 (pcaF-2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSEEN2795 (pcaF-2)
   00072 Synthesis and degradation of ketone bodies
    PSEEN2795 (pcaF-2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSEEN2795 (pcaF-2)
   00310 Lysine degradation
    PSEEN2795 (pcaF-2)
   00380 Tryptophan metabolism
    PSEEN2795 (pcaF-2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSEEN2795 (pcaF-2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSEEN2795 (pcaF-2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSEEN2795 (pcaF-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pen04147]
    PSEEN2795 (pcaF-2)
Enzymes [BR:pen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSEEN2795 (pcaF-2)
Exosome [BR:pen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSEEN2795 (pcaF-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAK15574
UniProt: Q1I9V0
Position
2933759..2934979
Genome map
AA seq 406 aa AA seqDB search
MTEATLPHALIIDAVRTPIGRYGGALSSVRADDLAAVPIKALMARHPELDWSAIDDVILG
CANQAGEDNRNVARMASLLAGLPLCVPGSTINRLCGSGLDAIGNAARALRCGEAGLMLAG
GVESMSRAPFVMGKAEQAFGRNTELFDTTIGWRFVNPLMKAQYGIDSMPETAENVAEQFA
ISREDQDAFALRSQLKAAAAQASGRLAREIVPVEIAQRKGPPKCVEHDEHPRGDTTLEQL
ARLGTPFRADGSVTAGNASGVNDGACALLLASPEAARRHGLKARGRVLGLATAGVEPRIM
GIGPVPATRKVLALTGLSLADMDVIELNEAFAAQGLAVLRELGLADDDPRVNPNGGAIAL
GHPLGMSGARLVTTALHQLEATAGRYALCTMCIGVGQGIALVIERL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagccaccctgccccacgccctgatcatcgacgccgtgcgcacgcccatcggc
cgctatggcggcgccctgtcgagcgtgcgcgccgacgacctggccgccgtgccgatcaag
gcactgatggcgcgccaccccgaactggactggagcgccatcgacgacgtgatcctcggc
tgcgccaaccaggccggcgaggacaaccgcaacgtcgcgcgcatggccagcctgctggcc
gggctgccgctgtgcgtaccaggctcgacgatcaaccgcctctgtggctcgggcctggac
gccatcggcaacgccgcccgcgccctgcgctgcggcgaggccgggctgatgctggccggc
ggcgtcgagtcgatgtcccgggcgccgttcgtgatgggcaaggcggagcaggccttcggc
cgcaacaccgagctgttcgacaccaccatcggctggcgcttcgtcaacccactgatgaaa
gcgcagtacggcatcgactcgatgcccgaaaccgccgagaacgtcgccgagcagttcgcc
atctcccgcgaggaccaggacgccttcgccctgcgcagccagctcaaggccgccgccgcc
caggccagtgggcgcctggcgcgggagatcgtgccggtcgagattgcccagcgcaaaggc
ccgcccaaatgcgtcgaacacgatgagcaccctcgtggcgacaccacgctggagcaactg
gcccgcctgggcacgccgttccgcgccgacggcagtgtaaccgccggcaacgcctccggg
gtcaatgacggcgcttgcgccctgctgctggccagccccgaggccgcgcgtcgccatggg
ttgaaagcccgtggccgggtgctaggcctggccacggcgggcgtcgaacctcgcatcatg
ggcatcggcccggtacctgccacccgcaaggtgctggcactgaccgggctgtcgctcgcc
gacatggacgtgatcgagctcaacgaagccttcgccgcccagggcctggccgtattgcgc
gagctgggcctggccgacgacgacccgcgggtcaaccccaacggcggcgccatcgccctg
ggccacccgctgggcatgagcggcgccaggctggtcaccaccgcccttcaccagctggag
gcgacggcaggccgctacgccctgtgcaccatgtgcatcggcgtcggccagggcatcgcc
ctggtgatcgagcgcctctga

DBGET integrated database retrieval system