KEGG   Pseudomonas entomophila: PSEEN3549Help
Entry
PSEEN3549         CDS       T00362                                 

Gene name
fadDx
Definition
(GenBank) acetyl-coA synthetase/AMP-(fatty) acid ligase FadDx
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pen  Pseudomonas entomophila
Pathway
pen00010  Glycolysis / Gluconeogenesis
pen00620  Pyruvate metabolism
pen00640  Propanoate metabolism
pen00680  Methane metabolism
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01130  Biosynthesis of antibiotics
pen01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEEN3549 (fadDx)
   00620 Pyruvate metabolism
    PSEEN3549 (fadDx)
   00640 Propanoate metabolism
    PSEEN3549 (fadDx)
  Energy metabolism
   00680 Methane metabolism
    PSEEN3549 (fadDx)
Enzymes [BR:pen01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PSEEN3549 (fadDx)
Lipid biosynthesis proteins [BR:pen01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PSEEN3549 (fadDx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAK16284
UniProt: Q1I7U4
Position
complement(3825810..3827456)
Genome map
AA seq 548 aa AA seqDB search
MRDYAEAARSFDHAQAAAAALHGNFEALNACVECCDRHAGMGKTALVWEDRDGDGGRYSF
DQLQALAARFANVLKAQGVGAGDRVAGLMPRTPELLVTILATWRLGAVYQPLFTAFGPKA
IEHRLEQSHAKVVVTDRNNRPKLDDVADCPTIVTVGAAEGELDFQRSLEAAASDCAPVMR
TGNDPFLLMFTSGTTGPAKPLEVPLRAIVAFQGYMRDAIDLRPEDNFWNLADPGWAYGLY
YAVTGPLSLGHATTFYDGPFSVESCARVIDKLGITNLAGSPTAYRLLIAAGSAFSAPIKG
RLRVVSSAGEPLNPEVIRWFADELGVTIHDHYGQTELGMVLCNHHALSHPVHLGSAGFAI
PGHRIVVVDEQGNELPAGQPGILAVDREQSPLCWFAGYHGLPTKAFVGKYYLSGDTVELN
QDGSISFVGRSDDVITTSGYRVGPFDVESALVEHPAVVEAAVIGKPDPERTELIKAFVVL
GKGFEGSPELEETLRQHVRQRLYAHAYPREIEFVGELPKTPSGKLQRFILRNQEIARQQA
AQPIAAGA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgattacgccgaagccgcccgttcgttcgaccatgcccaggctgctgcggcggcg
ctgcatggcaacttcgaggccctcaacgcttgtgtcgagtgctgcgaccgccacgccggc
atgggcaaaaccgctctggtctgggaagaccgtgacggcgacggcgggcgatactccttt
gaccagttgcaggccttggccgcgcgctttgccaatgtgctcaaggcgcaaggcgtaggg
gcgggtgaccgggtcgccgggctgatgccgcgtaccccggaactgttggttaccattctc
gccacctggcgcctgggcgcggtctatcagccgctgtttaccgcgttcgggcccaaagcc
atcgagcaccgcctcgagcagtcccatgccaaggtagtggtcactgaccgcaacaaccga
cccaagctcgacgacgtggcggattgcccgaccatcgtcacggtcggcgcggccgagggc
gagctggacttccagcgcagccttgaagccgccgccagcgattgcgcgccggtgatgcgc
acgggcaacgatccgttcctgctgatgttcacctcaggcaccacggggccggccaagccg
ctggaagtaccgctgcgggccatcgtcgccttccagggctacatgcgcgacgccatcgac
ctgcgcccggaggacaacttctggaacctggccgacccaggttgggcctatgggctctat
tacgctgtcaccgggccgctttcgctgggccacgccaccacgttctacgacggcccgttc
agcgtcgaaagctgcgcccgggtcatcgacaagctgggcatcaccaacctggcgggttca
ccgacggcctatcgcctgttgatcgcggcgggcagcgcgttctcggcaccgatcaagggc
cgcctgcgcgtggtcagcagtgccggcgaaccgctcaaccccgaagtgatccgctggttc
gccgacgagctcggggtgaccatccacgaccactacggccagaccgagttgggcatggtg
ttgtgcaaccaccatgcgctgtcgcatccggtacacctgggctcggccggtttcgccatc
cctggccatcgcatcgtggtggtggacgagcagggcaacgaactgccagccggccagccc
ggtatcctcgcggttgaccgcgagcagtcgccgctgtgctggttcgccggttaccacggg
ttgccgaccaaggccttcgtcggcaagtactacctgtccggcgacaccgtcgaactcaac
caggacggcagcatcagcttcgtcggccgcagcgacgatgtgatcaccacctccggctac
cgggtcggcccgttcgacgtggagagcgcactggtcgagcacccggcggtggtcgaggcg
gcagtgatcggcaagccggatcctgagcgcaccgagctgatcaaggccttcgtggtgctt
ggaaagggcttcgagggcagccccgagctggaggaaaccttgcgccagcacgtacgccag
cgcctttatgcccacgcctatccccgtgaaatcgaattcgtcggcgagctgcccaagacc
ccgagcggcaagctgcaacgcttcatcctgcgcaaccaggaaatcgcccgacaacaagcc
gcgcagccgatcgctgcgggcgcctga

DBGET integrated database retrieval system