KEGG   Pseudomonas entomophila: PSEEN3933Help
Entry
PSEEN3933         CDS       T00362                                 

Definition
(GenBank) putative agmatinase
  KO
K12255  guanidinobutyrase [EC:3.5.3.7]
Organism
pen  Pseudomonas entomophila
Pathway
pen00330  Arginine and proline metabolism
pen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PSEEN3933
Enzymes [BR:pen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     PSEEN3933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAK16639
UniProt: Q1I6U3
Position
4227968..4228930
Genome map
AA seq 320 aa AA seqDB search
MRPTVDKILHQPLGGNEMPRFGGIATMLRLPHLQSAAGLDAAFIGVPLDIGTSLRSGTRF
GPRQIRAESVMIRPYNMATGAAPFDSLSVADIGDVAINTFNLLDAVRIIEEAYDEIVEHN
VIPMTLGGDHTITLPILRALHKKHGKIGLVHIDAHADVNDHMFGEKIAHGTTFRRAVEEG
LLDCDRVVQIGLRAQGYTADDFNWSRRQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVY
LSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCHGLDLIGCDLVEVSPPYDTTGNTS
LLGANLLFEMLCVLPGVVRR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccaccgtggacaagattctccaccaaccactgggcggcaacgaaatgccgcgt
ttcggcggcatcgccaccatgcttcgccttccccacctgcaaagcgccgcgggcctggac
gccgccttcatcggcgtgcccctggatatcggcacctcgctgcgctcgggcacccgcttc
ggcccgcggcagatccgcgccgagtcggtgatgatccgcccgtacaacatggccaccggc
gccgccccgttcgactcgctgtcggtggccgacatcggtgacgtggcgatcaacaccttc
aacctgctggacgccgtgcgcatcatcgaagaggcctacgacgagatcgtcgagcacaat
gtcatcccgatgaccctgggtggcgaccacaccatcaccctgcctatcctgcgcgccctg
cacaagaagcacggcaagatcggcctggtgcacatcgatgcccacgctgacgtcaacgac
catatgttcggcgagaagatcgcccacggcaccaccttccgccgcgcggtggaggaaggc
ctgctcgattgcgaccgcgtggtgcagatcggcctgcgcgcccagggctacaccgccgac
gacttcaactggagccgccgccagggcttccgtgtggtgcaggccgaagagtgctggcac
aagtcgctggaaccgctgatggccgaagtgcgtgaaaaggtcggtggcggcccggtgtac
ctgtcgttcgacatcgacggcatcgacccggcctgggcgcctggcaccggcaccccggag
atcggcggcttgaccaccatccaggcgatggagatcatccgcggttgccacggcctggac
ctgatcggctgtgacctggtcgaagtctccccaccctacgacaccaccggcaacacctcg
ttgctgggcgccaacctgttgttcgaaatgctctgcgtgctgccaggcgtggtgcgccgc
taa

DBGET integrated database retrieval system