KEGG   Pseudomonas entomophila: PSEEN4056Help
Entry
PSEEN4056         CDS       T00362                                 

Gene name
mqo-2
Definition
(GenBank) malate dehydrogenase, FAD/NAD(P)-binding domain
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pen  Pseudomonas entomophila
Pathway
pen00020  Citrate cycle (TCA cycle)
pen00620  Pyruvate metabolism
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01130  Biosynthesis of antibiotics
pen01200  Carbon metabolism
Module
pen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pen_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSEEN4056 (mqo-2)
   00620 Pyruvate metabolism
    PSEEN4056 (mqo-2)
Enzymes [BR:pen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     PSEEN4056 (mqo-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: CAK16752
UniProt: Q1I6I3
Position
complement(4352821..4354458)
Genome map
AA seq 545 aa AA seqDB search
MFKKAGKTLLGLAVAASFMQAHAADTKKVDVLLVGGGIMSSTLAVWLNELEPSWSMEMVE
RMDGVAEESSNGWNNAGTGHSALAELNYTPLDKDGKVNITKAIEINESFQISRQFWAWQV
RQGVLQNPHSFINTTPHMSFVWGDDNIKFLKQRYEALQASPLFRSMQYSEDHAQIAKWVP
LMMEGRDPNQKLAVTWTPIGTDVNFGEITRQFVGHLKTKENFDLKLSSEVQDITRNEDGS
WHVEYKNLKDGTESATDAKFLFIGAGGGALKLLQKSGIPEAKEYAGFPVGGSFLVTENPT
VAMQHMAKAYGIASTGAPPMSVPHLDTRVLDGKRVILFGPFATFSTKFLKNGSYLDLLSS
TTTHNMWPMARVGIDQYPLVEYLAGQLMQSDDDRFAALQTYFPNAKKEDWKLWQAGQRVQ
IIKRDEEKGGVLKLGTEVVASQDRTIAGLLGASPGASTAAPIMLNVLETVFKEKVATPEW
QAKIKEIVPSYGTKLNDSAAATQKEWNYTAEVLQLEKPPVIDQSVGTTVVPRAPVESKPA
NDMAL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaaagctggcaagaccttgctgggtctggcagtcgcggcgagcttcatgcaa
gcgcacgccgcagacaccaagaaagtcgacgtgctgctggtcggcggcggcatcatgagt
tccaccctggctgtctggctcaacgagctggaaccaagctggtcgatggaaatggtcgag
cgcatggacggcgtcgccgaagaaagctccaacggctggaacaacgccggtaccggccac
tccgcgctggccgagctcaactacaccccgctggacaaagacggcaaggtcaacatcacc
aaggccatcgagatcaacgagtcgttccagatctcccgccagttctgggcctggcaggtg
cgccagggcgtgctgcagaacccgcactcgttcatcaacactaccccgcacatgagcttc
gtctggggcgatgacaacatcaagttcctgaagcagcgctacgaggccctgcaggccagc
ccgctgttccgttcgatgcagtattcggaagaccacgcgcagatcgccaagtgggtgccg
ctgatgatggaagggcgcgacccgaaccagaagctggccgtgacctggacgccgatcggc
accgacgtcaacttcggtgagatcacccgccagttcgtgggtcacctgaagaccaaagag
aacttcgacctgaagctgtccagcgaagtgcaggacatcacccgcaacgaagacggctcc
tggcacgtcgagtacaagaacctgaaggacggtaccgaatcggccaccgacgccaagttc
ctgttcatcggtgccggtggcggcgcgctgaagctgctgcagaaatcgggcatcccggaa
gccaaggaatacgcaggcttcccggtgggcggctcgttcctggtgaccgagaacccgacc
gttgccatgcagcacatggccaaggcctacggcatcgcctcgaccggcgcgccacccatg
tcggtaccgcacctggacacccgcgtgctcgatggcaagcgcgtgatcctgttcgggcca
ttcgccaccttctcgaccaagttcctgaagaacggctcgtacctggacctgctgagcagc
accaccacccacaacatgtggccgatggcgcgtgtcggtatcgaccagtacccactggtg
gaatacctggccggccagctgatgcagtctgacgacgaccgcttcgccgccctgcagacc
tacttcccgaacgccaagaaggaagactggaaactgtggcaggccggccagcgcgtgcag
atcatcaagcgtgacgaagagaagggcggcgtgctgaagctgggcaccgaagtcgtcgct
tcccaggaccgcaccatcgccggcctgctgggcgcctcgccaggtgcctcgaccgccgcg
ccgatcatgctcaacgtgctggaaaccgtgttcaaggagaaggtcgccacccctgagtgg
caggccaagatcaaggagatcgtcccgagctacggtaccaagctgaacgattcggccgct
gccacccagaaagagtggaactacaccgccgaagtgctgcagctggaaaaaccgccagtg
atcgaccagagcgtcggtaccaccgtcgtgccacgcgcaccggtcgagagcaagcctgcg
aacgacatggcgctgtaa

DBGET integrated database retrieval system