KEGG   Pseudomonas entomophila: PSEEN4635Help
Entry
PSEEN4635         CDS       T00362                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pen  Pseudomonas entomophila
Pathway
pen00071  Fatty acid degradation
pen00072  Synthesis and degradation of ketone bodies
pen00280  Valine, leucine and isoleucine degradation
pen00310  Lysine degradation
pen00362  Benzoate degradation
pen00380  Tryptophan metabolism
pen00620  Pyruvate metabolism
pen00630  Glyoxylate and dicarboxylate metabolism
pen00640  Propanoate metabolism
pen00650  Butanoate metabolism
pen00900  Terpenoid backbone biosynthesis
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01130  Biosynthesis of antibiotics
pen01200  Carbon metabolism
pen01212  Fatty acid metabolism
pen02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSEEN4635 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    PSEEN4635 (phbA)
   00640 Propanoate metabolism
    PSEEN4635 (phbA)
   00650 Butanoate metabolism
    PSEEN4635 (phbA)
  Lipid metabolism
   00071 Fatty acid degradation
    PSEEN4635 (phbA)
   00072 Synthesis and degradation of ketone bodies
    PSEEN4635 (phbA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSEEN4635 (phbA)
   00310 Lysine degradation
    PSEEN4635 (phbA)
   00380 Tryptophan metabolism
    PSEEN4635 (phbA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSEEN4635 (phbA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSEEN4635 (phbA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSEEN4635 (phbA)
Enzymes [BR:pen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSEEN4635 (phbA)
Exosome [BR:pen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSEEN4635 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAK17309
UniProt: Q1I4X7
Position
4944268..4945491
Genome map
AA seq 407 aa AA seqDB search
MDAVAITLVSRRTTMNEVVIVAATRTAIGSFQGALANVSAVELGAAVIRQLLAQTQLDPA
QVDEVILGQVLTAGAGQNPARQAAVKAGLPYEVPALTLNKVCGSGLKALHLAAQAIRCGD
AEVVIAGGQESMSLAPYVMPSARTGQRMGHGQLIDSMITDGLWDAFNDYHMGITAENLVD
KYGLTREQQDAFAAESQRKAVAAIEAGRFKDEITPIHIPQKKGEPLVFDTDEQPRPGTSA
ESLAKLRAAFKKDGSVTAGNASSLNDGAAAVLLMSADKAKALGLPVLAKIAAYASAGVDP
AIMGIGPVSATQRCLDKAGWQLGELDLIEANEAFAAQALAVGKQLEWDAAKVNVNGGAIA
LGHPIGASGCRVLVTLLHEMIKRDAKKGLATLCIGGGQGVALAIERG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgtggcgatcacgctcgtatcccggagaacaacaatgaacgaagtcgtcatc
gtcgccgccacccgcactgccatcggcagcttccagggggccctggccaacgtgtccgcc
gtcgagctgggcgccgccgtgatccgccagctgctggcccagacccagctggacccggcc
caggtcgacgaagtgatcctcggccaggtgctcaccgcgggcgccggccagaaccccgcc
cgccaggccgccgtgaaggccggcctgccctacgaagtcccggccctgaccctgaacaaa
gtctgcggctcgggcctcaaggccctgcacctggccgcccaggccatccgctgcggcgac
gccgaggtggtgatcgccggtggccaggagagcatgagcctggcgccctatgtgatgccc
tcggcccgtaccggccagcgcatgggccacggccagctgatcgacagcatgatcaccgac
ggcctgtgggacgccttcaacgactaccacatgggcatcaccgccgagaacctggtggac
aagtacggcctcacccgcgagcaacaggacgccttcgccgccgaatcgcagcgcaaggcc
gtggccgccatcgaggccgggcgcttcaaggacgagatcaccccgatccacatcccgcag
aagaaaggcgagccgctggtgttcgacaccgacgagcaaccccgccccggcaccagcgcc
gagtccctggccaagctgcgcgctgcattcaagaaggacggcagcgtcaccgccggcaac
gcctccagcctcaacgacggtgctgccgcagtactgctgatgagcgccgataaagccaag
gccctcggcctgccggtgctggccaaaatcgccgcctacgccagcgcgggtgttgacccg
gcgatcatgggtatcggcccggtgtcggccacccagcgctgcctggacaaggctggctgg
cagctgggtgagctggacctgatcgaagccaacgaagccttcgccgcccaggcgctggcc
gtgggcaaacaactggaatgggatgccgcgaaggtcaacgtcaacggcggcgcgattgcc
ctgggccaccccatcggcgcctcgggctgccgggtgctggtgaccctgctgcacgaaatg
atcaagcgtgatgccaagaaagggctggcgaccctgtgcatcggcggcggccagggcgtg
gcgctggcgatcgagcgcggttga

DBGET integrated database retrieval system