KEGG   Prevotella enoeca: AS203_02585Help
Entry
AS203_02585       CDS       T04173                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
peo  Prevotella enoeca
Brite
KEGG Orthology (KO) [BR:peo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:peo01002]
    AS203_02585
Enzymes [BR:peo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     AS203_02585
Peptidases and inhibitors [BR:peo01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   AS203_02585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49 DUF5105
Motif
Other DBs
NCBI-ProteinID: ALO48112
UniProt: A0A0S2KIL7
Position
577052..579004
Genome map
AA seq 650 aa AA seqDB search
MEQDFIYTDEHFADLQLLRYKLNGFEELSARQKAYIYYLSQATLAGRDITTDQFGRYNLR
IRKVLEAIYIRYSGPRDCADFKALEVYLKRLWFSNGIYHHYGCEKFQPEFSESFLKNEIM
KLCKSDWPLEQEGIRAQDFIDEVFPVIFDASVLSKRVNKSVGEDLVQTSACNFYDGVTQK
EVETYYNRLKSTEDEEPPSWGLNSTVVKDGNEIREIQWTENGRYGRAIRAIIHWLEKAKD
VAENQQQQRVIRLLIDYYRTGDLKIFDRYSIEWLQEQAGRVDFINGFIEVYGDPLGLKGS
WEGIVEYKDMEATRRTQAICRNAQWFEDHSPVDERFRKREVRGVTAHVVCAAMLGGDEYP
STAIGINLPNADWIRARYGSKSVTIGNLTEAYNKAAHGNGFYEEFVCDETTRALIDRYGD
LCDDLHTDLHECLGHGSGRLLPGVDSDALKEYGNTIEEARADLFGLYYIADDKLIELGLL
PDKQAHQSQYYTYMLNGLMTQLTRIRPGHCIEEAHMRNRALIAHWVYEHAKGAVSLVYRG
GKTSVVINDYQALRTLFAQLLAEIQRIKSEGDFDAARNLVEKYAVSVDEVLHREVLERYA
RLHLAPYKGFINPWMKPVLNEQNEIIDVKLDYTETYSHQMLRYSEEFGLL
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggattttatatatacggacgagcattttgccgacttgcaattgctgcgttac
aaactcaacggctttgaagaactgtctgcccggcagaaagcctatatttattatctgtct
caggccacacttgcggggcgagacatcacgaccgatcagtttggtcgatataatctgcgg
attcgaaaagttttggaggctatatatataaggtatagcggaccgagagattgtgccgat
ttcaaggcgttggaagtgtacctcaaacgactgtggttctctaacgggatttatcatcat
tatggttgtgagaagtttcaaccggagttctcggaatcttttttgaagaatgagatcatg
aagttgtgcaaatccgattggcctttggaacaagaggggatacgggcgcaggattttatc
gacgaggttttccctgtgatcttcgacgcatcagtgctgtccaaacgcgtaaacaagtcg
gttggcgaggatttggtgcagacttcggcctgcaatttttatgacggtgtgacgcaaaag
gaggttgagacgtattataacagactgaaatcgaccgaggatgaagagccgccatcgtgg
ggattgaactcgactgtggtgaaagacggtaatgagatccgtgaaatccaatggacggaa
aacggacgatatggacgtgccattcgtgcgattatccattggttggagaaggcaaaggat
gtggctgagaaccaacagcagcagcgtgtgatccgattactcatcgactattatcgcacg
ggcgatttgaagattttcgatcgctattccatcgaatggcttcaagaacaagcggggcgg
gtggatttcattaatggctttatcgaagtctatggagatccgctcggtttgaaaggttct
tgggagggaattgttgaatataaagacatggaagcaacgcgtcgcacgcaggctatatgt
cgcaatgcacagtggtttgaggatcattcacctgtggatgagcgtttccgcaaacgtgag
gtacgcggcgtgacagcccatgtggtgtgtgctgcgatgctcggtggcgatgaatatccc
tctacagccataggaatcaatctgcccaatgccgattggatcagagcgcgatatggttcg
aagagtgtcacgatcggcaatctcaccgaggcatataataaggctgcacacggcaatggc
ttctatgaagaatttgtttgtgatgaaacgacacgggcattgattgatcgttatggcgat
ctctgcgatgatttgcacaccgatctgcatgaatgcttaggccacggaagtggtcggttg
ctccctggagtggattcagacgccctcaaagagtacggaaacacaatcgaagaagcgcgt
gccgatctgttcggactttattatattgctgacgacaaactcattgagctgggacttctg
cccgataaacaagctcatcaatcacaatattacacgtatatgctcaatggtttgatgacg
caactcacgcgcattcgtccggggcattgcatcgaagaggcgcatatgcgcaaccgtgca
ctcattgcacattgggtctatgaacatgccaaaggagctgtctcgttggtttatcgaggc
ggaaaaacatctgtggtgatcaatgattatcaggcattgagaactctttttgcacagctc
ttggccgaaatccagcgtatcaagagtgagggtgatttcgacgcagcgcgtaatttggtg
gagaaatatgcagtcagcgtagacgaagtattgcatcgcgaggtgttggaacgctatgcc
cgtctgcatcttgcaccttataagggattcatcaatccatggatgaaacccgttttgaat
gaacagaacgagatcatagatgtcaagctcgactacacagagacttattcgcatcagatg
ctacgttatagcgaggaattcggattgttatga

DBGET integrated database retrieval system