KEGG   Pedobacter sp. PACM 27299: AQ505_23220Help
Entry
AQ505_23220       CDS       T04140                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pep  Pedobacter sp. PACM 27299
Pathway
pep00511  Other glycan degradation
pep00600  Sphingolipid metabolism
pep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AQ505_23220
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AQ505_23220
Enzymes [BR:pep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AQ505_23220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2 DUF5640 LBP_C
Motif
Other DBs
NCBI-ProteinID: ALL08132
UniProt: A0A0P0NKK1
Position
5539654..5541081
Genome map
AA seq 475 aa AA seqDB search
MRLLNLSVIAALALSSCASKKETPVTTGVESWITSGDRSALLQKQKTPLHFSTAMNNHLN
IVVDEQQTFQTMDGFGYTLTGGSATLMNGLPAAEKKAMLKEIFSTDGNGIGISYLRLSVG
ASDLSAETFTYNEMPKGQTDPELKNFSIAKEMTDLVPMLKEIIAINPKIKIMGSPWTAPT
WMKDNQAYRGGSLKPEYYQVYAKYFVKYIEAMKAQGIVIDAVTIQNEPLHPGNNPSMYMT
PQDQANFVKTALGPVFKAAGIKTKIIIYDHNADRPDYPITILKDPEANQYIDGSAFHLYG
GQISALSQVHEAFPNKNIYFTEQWVGGPGDFAKDLKWHVATLMIGAPRNWSKTVLEWNLA
ADPQYRPFTPDGGCTSCLGAITVDGKSWSKNIAFYSIGQTSKFVPTGSVRIASNQNDKIQ
NVAYKTPAGQLVLVTVNNSDETQTFNIKYNGQVVNTTLAAGSAGTYLWNSKPRTK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagattattaaatttaagcgtgattgctgccctggcattgagctcatgtgccagcaaa
aaagagacaccagtaactactggcgtggaatcatggatcaccagcggcgaccgttctgcc
ctattgcaaaagcaaaaaacacctttacatttttctacagcgatgaataaccacctcaat
attgtagtagatgaacagcagactttccaaactatggatggctttggctataccttaacc
ggtggtagtgctaccttgatgaacggacttcctgccgcagagaaaaaggcaatgttaaaa
gagatcttctctacagatggtaatggtattggcattagttacctgcgcttgagcgtgggt
gcttcagatttaagtgcagaaaccttcacttataatgaaatgccaaaaggacaaaccgat
ccggaactaaaaaacttctctattgcaaaagagatgaccgacctggttccaatgttaaaa
gaaatcattgccatcaatccaaaaatcaaaatcatgggttctccatggacggcgcctacc
tggatgaaagacaatcaagcttaccgtggtggtagtttaaaaccggaatattatcaggtt
tatgccaaatatttcgtgaaatatattgaggcaatgaaagcacaaggtatcgtcattgat
gcggtaacgatccaaaacgagccattacatccgggcaacaacccaagtatgtacatgacg
ccgcaagatcaggccaacttcgtgaagactgctttaggtccggtatttaaagccgcaggc
atcaaaactaaaattatcatttatgatcataatgcggatcgtccggattatccaatcact
attttaaaagatccggaagctaaccagtatatcgatggttctgctttccatttatatggt
ggacaaatctctgctttatcacaagtgcatgaagccttccctaataaaaacatctatttt
acagagcaatgggtaggtggccctggtgatttcgccaaggacttaaaatggcatgttgca
accttaatgattggtgcaccaagaaactggagtaaaaccgtattggaatggaacctggca
gcagatccacagtaccgcccatttacaccagatgggggttgtaccagctgtttaggtgca
attacggtagatggtaagagctggagcaagaacatcgccttttactctatcggtcagact
tctaaatttgtaccaactggttctgtacgtattgcttcaaatcaaaacgataaaattcag
aatgttgcttataaaacaccagcaggacaactagtattagtgacagtgaacaacagtgat
gagacacaaaccttcaacattaaatacaatggccaggtcgtaaatactacacttgctgca
ggttctgctggaacttacctctggaacagcaagccaagaactaaataa

DBGET integrated database retrieval system