KEGG   Phalaenopsis equestris: 110019053Help
Entry
110019053         CDS       T05601                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: stromal 70 kDa heat shock-related protein, chloroplastic-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
peq  Phalaenopsis equestris
Pathway
peq03040  Spliceosome
peq04141  Protein processing in endoplasmic reticulum
peq04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:peq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110019053
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110019053
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110019053
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:peq01009]
    110019053
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:peq03041]
    110019053
   03009 Ribosome biogenesis [BR:peq03009]
    110019053
   03110 Chaperones and folding catalysts [BR:peq03110]
    110019053
   04131 Membrane trafficking [BR:peq04131]
    110019053
   03051 Proteasome [BR:peq03051]
    110019053
   03029 Mitochondrial biogenesis [BR:peq03029]
    110019053
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:peq04147]
    110019053
Protein phosphatases and associated proteins [BR:peq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110019053
Spliceosome [BR:peq03041]
 Complex B
  Other components
   Prp19 complex
    110019053
 Complex C
   Prp19-CDC5 complex
    110019053
Ribosome biogenesis [BR:peq03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110019053
Chaperones and folding catalysts [BR:peq03110]
 Heat shock proteins
  HSP70 / DNAK
   110019053
Membrane trafficking [BR:peq04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110019053
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110019053
Proteasome [BR:peq03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110019053
Mitochondrial biogenesis [BR:peq03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110019053
Exosome [BR:peq04147]
 Exosomal proteins
  Proteins found in most exosomes
   110019053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA FGGY_C Baculo_PEP_C DUF5398 IFT57
Motif
Other DBs
NCBI-GeneID: 110019053
NCBI-ProteinID: XP_020572246
Position
Unknown
AA seq 806 aa AA seqDB search
MASVSFEEGFENDIEALLREQQKHHHQSRASINRERDLNVYRSGSAPPTVEGSRNAIGSL
FGRSEVGGFEGQNAKDELLEEEMRSQLAYMSYYYSNENLNPRLPPPLLSKEDWRVAQRFG
PGGSGLGGIGDRRGRKPSFESDGSSRSLFSMQPSLLAQDEKESMEHGGEWLERGRDGLIG
LPESGLGTRRRSFADVLQIADSSINATSFQCLLTQIAFALFNILQSGYFLGNPENTILVK
RFIGWKPSEVDEEAKQVSYRVLRDENGNVKLDCPAIGKQFAAEEISAQVLRKLVDDASKF
LNDKVTKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFQKKNNETIL
VFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDWLASNFKRDEGIDLLKD
KQALQRLTETAEKAKMELSTLTQTNISLPFITATADGPKHIETTITRAKFEELCSDLLDR
LRTPVDNSLRDAKLSVSDLDEIILVGGLXPAVQELVRKITGKEPNVTVNPDEVVALGAAV
QAGVLSGDVSDIVLLDVTPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADGQTSVE
INVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVTAVDKGTGKKQ
DITITGASTLPNDEVDRMVKEAEKFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGEKV
PAAVKEKVEAKLKGLKDAISGGSTQSIKDAMTALNQEVMQLGQSLYNQPGAPGTGPAPGA
DAGSTGGASKGPDGGDVIDADFTDSK
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggtgagttttgaggagggtttcgagaacgacatagaggcgctacttcgcgaa
cagcagaaacatcaccatcaaagccgagcatccattaatcgagagagggatctcaatgtc
tatcgcagtgggagtgctccgccgactgttgaagggtcgaggaacgccatcgggagcttg
tttggccgatcagaagtcggtggatttgagggacagaacgctaaggatgagttgttggag
gaggagatgcgatcgcaacttgcttacatgtcttactactactctaatgagaatctgaat
ccacggctacctcctcctttgctgtctaaggaggattggcgtgtggcgcagaggtttggg
cctggtgggtctgggttaggagggattggtgatcggagggggaggaagccatcgtttgaa
agtgatggaagtagccgctctcttttttcaatgcaacccagtcttttggcgcaagatgag
aaggaatccatggagcatggtggggaatggctggagaggggacgagatggtctgataggg
ttgccggagagtgggcttggaacaaggagaaggagcttcgctgatgttttgcagattgcg
gatagtagcataaatgccacctcattccaatgtttgcttactcaaattgcttttgcgctt
tttaacattttgcaaagtggctactttttggggaatcccgagaataccatcttagtgaag
cggttcatcggctggaagccgtcggaggttgacgaggaggccaagcaggtttcgtacagg
gttttgagagatgagaacgggaatgtgaaactcgattgcccggcgattgggaagcaattt
gctgctgaagagatctcggcacaggttttgagaaagttagttgatgatgcatcaaagttt
ttaaatgacaaggtcaccaaagctgttgtcactgttcctgcatacttcaatgattcccaa
agaacagcgacaaaggatgctggtcgtattgctggtttagaagtcctccgtatcatcaac
gagccaacggctgcatctttggcatatggttttcagaagaagaataatgaaacaattttg
gtatttgacttgggaggtggcacctttgatgtttcagttcttgaggttggagatggcgtt
tttgaggtgctgtctacatctggtgatactcatcttggtggggatgactttgacaagagg
attgttgactggcttgcttcgaactttaaaagggatgaaggaattgaccttctaaaggat
aaacaagcactccagagactaactgagacagctgagaaagctaagatggagttatcaact
ttaactcagacaaatatcagcttgccgttcattactgctactgctgatggccccaaacac
atagagacaactatcacaagggcaaaatttgaggaactatgctcggaccttcttgacagg
cttagaactcctgtagataattccttaagggatgcaaaactatcagtctcggatttggat
gagattatccttgtgggtggacttnntcctgctgtgcaggaactagtgagaaagataact
ggaaaggaaccaaatgtaacagttaaccctgatgaggttgttgcccttggtgctgcagtt
caggctggagtattgtccggagatgtcagtgacattgttcttctggacgtgacaccttta
tctcttggtttagagacattgggtggcgtgatgacaaagattattccaagaaacaccaca
ctgcccacctctaaatcagaggtcttctcgaccgcagcagatggtcagactagtgtcgag
atcaatgttctgcagggtgaaagagaatttgtgagggacaacaaatcattaggaagtttc
cgtcttgatggaattccaccagcacctcgtggggtaccacagattgaagtcaagtttgat
attgacgccaatggcattctctctgttactgcagtggacaagggtactggaaagaagcag
gacatcaccattacaggggctagcacgctgcccaatgatgaggtggataggatggtaaaa
gaggcagagaagtttgcaaaggaagacaaggagaagagagatgccatagacaccaagaac
caagcagactctgtagtgtatcaaactgagaagcagttgaaggagctgggagagaaggtt
cctgctgctgttaaagagaaggttgaggccaaactcaaggggctcaaggatgccatctct
ggtggatcaactcagagcatcaaggatgcaatgactgctttaaatcaggaggtgatgcag
cttggtcagtccctctacaaccagcctggtgcacctggcactggcccagcacctggtgct
gatgctggttctaccggcggagctagcaagggacccgatggtggtgatgtgattgatgcc
gatttcactgatagtaagtga

DBGET integrated database retrieval system