KEGG   Phalaenopsis equestris: 110020428Help
Entry
110020428         CDS       T05601                                 

Definition
(RefSeq) cyclin-dependent kinase B2-1-like
  KO
K07760  cyclin-dependent kinase [EC:2.7.11.22]
Organism
peq  Phalaenopsis equestris
Brite
KEGG Orthology (KO) [BR:peq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:peq01001]
    110020428
Enzymes [BR:peq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110020428
Protein kinases [BR:peq01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110020428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo APH
Motif
Other DBs
NCBI-GeneID: 110020428
NCBI-ProteinID: XP_020574184
Position
Unknown
AA seq 302 aa AA seqDB search
MDAYEKLEKVGEGTYGKVYKAREKATGNIVALKKTRLPEDDEGVPATTLREVSLLRMLSL
GPHIVRLLDLKQGQNKKGQSILYLVFEFMDGDLKKYIRSIRQNQELIPSQIVKTLMYQLC
KGIAFCHGHGVLHRDLKPHNILLDRKAMMLKIADLGLSRAFTLPVKKYTHEILTLWYRAP
EVLLGAKTYAAPVDIWSVGCIFAELVTTQALFTGDSELQQLLHIFRLLGTPNEEVWPGVS
KLANWHEYPQWTPKGLSTAVPNLDADGLDLLSKMLMYEPSKRISGKKALEHPYFDGLDKE
SL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgtacgagaagttggagaaagttggggagggaacttacggcaaagtctacaaa
gccagagagaaggccacaggaaacatagtggcgctcaagaagactagattgccggaggac
gacgagggagtgccggccaccactctccgagaggtttccctcctccggatgctctcactg
ggtccgcatattgtcaggctactggatttgaaacaaggccaaaacaaaaaagggcagtcg
attctctatctagtttttgaattcatggatggtgatcttaagaaatatatcagaagtatt
cgccagaatcaagagctgattccttcccaaattgttaagactcttatgtatcagctttgc
aagggcattgcattttgtcatggacatggtgtactacacagggatctgaagcctcataac
attctattggaccggaaggcaatgatgttaaagatagcggatctcgggctcagccgagcc
tttactcttccggttaagaaatatactcatgagatcctaacgctttggtatagggctcct
gaagtgcttcttggggctaaaacctatgcagcaccagttgatatttggtcagttggctgc
atatttgctgaactggtgacaacacaggcactcttcactggagattcagagttacagcag
ctcctccacattttcaggctacttggtacaccaaatgaagaagtttggccaggagtcagc
aaactagcaaactggcatgagtatcctcagtggaccccaaaaggcctatcaacagcagtt
cctaatcttgatgcagatggtcttgatctgctttcgaaaatgttgatgtatgagccatca
aagagaatttctggaaagaaggctttggagcatccttactttgatggtctggacaaagaa
tccctgtaa

DBGET integrated database retrieval system