KEGG   Phalaenopsis equestris: 110020647Help
Entry
110020647         CDS       T05601                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL23
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
peq  Phalaenopsis equestris
Brite
KEGG Orthology (KO) [BR:peq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:peq01001]
    110020647
Enzymes [BR:peq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110020647
Protein kinases [BR:peq01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110020647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH ABC1
Motif
Other DBs
NCBI-GeneID: 110020647
NCBI-ProteinID: XP_020574479
Position
Unknown
AA seq 399 aa AA seqDB search
MDVEEWRKERLALVLIFVLAVLAVSSLLIAFSYYCYIRYKVSIHRKSLMKSEDEEVGNAA
VCNGGEERAVVSEKGVQVFAYKQLYTATGGFGKANVVGHGSFGSVFRGVLPDGRKIAVKL
MDRPGKQGEEEFNMEVELLTRLRSHYLLGLIGYCSDSHHRLLVYEFMTNGGLQEHLYPTA
GSYGGVSMLDWETRMRIALEAARGLEYLHEHVRPPVIHRDFKSSNILLDKNFCAKVSDFG
LAKFGSEKAGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLTGRIPVDMN
RPPGEGVLVSWALPRLTDREKVVLILDPALEGQYSMKDAIQVAAIAAMCVQPEADYRPLM
ADVVQSLVPLVKHTKTATRTGSSSAGQTPKPAGTPEIVK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgaggaatggcggaaggaaagacttgcgttggttctcatcttcgttcttgct
gtcctcgccgtttcgtcactgctgattgcttttagctactactgctacattcgctataaa
gtttccatccaccgcaaatcattgatgaaaagtgaggatgaagaggtgggcaatgctgcg
gtttgtaacggcggcgaagagagagcggtggtaagcgagaagggtgtgcaggtgtttgca
tacaagcagctctatacggctacgggtggattcggtaaggccaatgtcgtcggtcatgga
agctttggttcggtattcaggggcgttcttcctgacgggaggaagatagccgttaagcta
atggatcgccccggaaagcagggcgaagaagagttcaatatggaggtcgagctactaact
cgtctccgatctcattatttactgggattgatcggctactgctccgatagtcaccacaga
ttgcttgtttatgagtttatgactaatggtggactccaggagcacttatacccaactgca
ggttcctatggtggtgtttcaatgttagactgggaaacacgaatgagaatagcgcttgaa
gctgcaagaggactggaatatcttcacgagcatgttaggccgcctgtaattcatcgagat
ttcaagagtagtaacatcctcttggataagaatttttgtgccaaagtttctgactttggt
ttagccaagtttggatctgaaaaagctggaggtcatgtttctacacgagttttagggacc
caaggatatgttgcaccggaatatgcattaactggacatttgacaacaaaatcagatgtg
tatagctatggagttgtgctcttggagctgcttacaggcaggattcctgtcgatatgaac
aggcctcctggtgaaggcgtcttggtatcttgggctctccccagacttactgacagggag
aaagtagtgctaatcttggatccggcgctggagggccaatattcaatgaaagatgccata
caagttgcagccatcgcagcaatgtgcgtacaacctgaagctgattacaggcctctaatg
gcggatgttgtgcagtcattagtcccactggtgaagcacactaagactgctactaggacc
ggaagctcttctgccggccaaacacccaaaccagctggaactcctgaaattgttaaatga

DBGET integrated database retrieval system