KEGG   Phalaenopsis equestris: 110020859Help
Entry
110020859         CDS       T05601                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
peq  Phalaenopsis equestris
Pathway
peq00020  Citrate cycle (TCA cycle)
peq00640  Propanoate metabolism
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
peq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110020859
   00640 Propanoate metabolism
    110020859
Enzymes [BR:peq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     110020859
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     110020859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 110020859
NCBI-ProteinID: XP_020574786
Position
Unknown
AA seq 339 aa AA seqDB search
MARQAAKLIRSLAYRISPPQNSASSSLSSLASQSRQFGSTPQPAVFVDKNTRVICQGITG
KTGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPSFA
SAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGI
MPGYIHKPGRIGVVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVKRFLP
DPQTEGIVLIGEIGGTAEEDAAALIKESKTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGK
GTAQDKIKTLREAGVTVVESPAKIGSTMLDIFKQRGLSE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctcggcaagcggcgaagctgatccgatctctagcctacaggatctcccctccgcag
aactcggcttcatcatcgctttcctctttggcatcgcaatcccgccaatttggatcgacg
cctcaacccgccgtgtttgttgacaagaacacgcgtgttatttgccaggggatcaccgga
aagaccggcacgtttcacacagagcaggccatcgagtacggaaccaaaatggttggcggt
gtgacgccaaagaagggtggaactgagcacttaggacttcctgtctttaactcagttgca
gaggcgaaggctgaaactaaagccaacgcatcagttatttatgtcccaccttcatttgct
tcagctgctattttagaagcaatggaggctgaactggaccttgtagtgtgcattactgag
ggaataccgcagcatgacatggttcgagtgaaagctgctcttaaccggcaatcaaaaact
cgacttattggaccaaactgtccaggtattattaaacccggagaatgtaagattggaatc
atgcctggttatatccataagccagggcgtattggtgtcgtttcacgatcgggtactttg
acctacgaagcggtgtttcaaacaactgctgttgggttgggacaatcaacatgtgtaggt
attggtggagatcccttcaatggaacaaattttgttgattgtgtaaaaagatttttgccg
gatccgcagaccgaaggtattgttcttatcggtgaaattggaggaactgccgaagaagat
gctgcagcattgataaaggaaagcaagacggaaaagccgattgtcgcattcattgctggg
cttactgcccctcccggacgaagaatgggccatgccggagctattgtgtctggtgggaag
ggcactgcccaggacaagatcaaaactctcagagaagcaggagtaactgtggttgaatct
ccagccaagataggttccaccatgctcgatattttcaagcagcgtggcctttcagaataa

DBGET integrated database retrieval system