KEGG   Phalaenopsis equestris: 110025566Help
Entry
110025566         CDS       T05601                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
peq  Phalaenopsis equestris
Pathway
peq03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:peq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110025566
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:peq03041]
    110025566
Enzymes [BR:peq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110025566
Spliceosome [BR:peq03041]
 Complex C
  Other components
   Step II factors
    110025566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 Sigma54_activ_2 ABC_tran CRIC_ras_sig PhoH Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 110025566
NCBI-ProteinID: XP_020581779
Position
Unknown
AA seq 1060 aa AA seqDB search
MPAAVMEAEDDLKKLEYLSLVSKVCTELENHVGCGDKILAEFITEHGRKAESVEEFDAKL
KENGAEMPDYFVRTLLAIIHAILPPKSKSKPTSDPSSKKESAAFPGLSRVDDRERIKELE
REIEKEAQVKAEEEGRYHDRDRDRDRNRDLRRDREHSRDHRGDRDHRYDRDRDIDRGRGR
GRSNRRDDYGDHRAYSDDDESDDGIRHGRTRSSRRISDEPELYEVYKGKVLRLMDNGCFV
ELSDFRGKEGLVHVSQIANRRVTNAKDEVKRGQDVYVKVISVSGKKLSLSMRDVDQNTGK
DLLPLRKSTENEALRTNPSSGNSGPVARKGLSGITIFEDDNNASSRRPLKRMSSPEKWEA
KQLIAAGVLDVREYPMFDEEGDGLLYQEEGAEEELEIELNEDEPAFLQGQSRFSIDMSPV
KIFKNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLA
QELRGIGLSAYDMPEWEKDAYGKALTFGQRSKLSIQEHRQSLPIYKLKKELIQAVYDNQV
LVVIGETGSGKTTQVTQYLAEAGYTTKGKIGCTQPRRVAATSVAKRVAEEFGCRLGEEVG
YAIRFEDCTGPETVIKYMIDGMLLREILVDDNLSQYSVIMLDEAHERTIHTDVXLVKRRP
ELRLIVTSATLDAEKFSRYFFNCNIFTIPGRTFPVEVLYTKHPESDYLDAVLITVLQIHL
TEPEGDILLFLTGQEEIDHACQSLYERMKGLDKNVPELIILPVYSALPSEMQSRIFEPAP
PGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAG
RAGRTGPGKCYRLYTESAYRNEMSPTTIPEIQRINLGTTTLNMKAMGINDLLSFDFMDPP
SPQALISAMEQLYSLGALDEEGLLTKLGRKMADFPLDPPLSKMLLASVDLGCSDEILTII
AMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQS
RSLRRAQDVRKQLLTIMDRYDFDELASFSSVRNNDLLHVW
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagcagtgatggaggccgaggacgacctcaagaagctcgagtatctttccctc
gtttccaaggtttgcaccgagcttgagaaccatgtcggttgcggcgataaaattctcgcg
gagttcatcaccgaacatggccggaaagccgagtctgttgaggaatttgacgccaagctc
aaggaaaacggagccgagatgcctgactacttcgtacgcactctcctcgccatcatacat
gcaatcttaccccccaaatcgaaatccaagcccacatctgacccctcttcgaagaaggaa
tctgccgcctttccagggctttctcgtgtcgatgatcgagagcgcatcaaggagctcgag
cgtgagatcgagaaggaggctcaggttaaagcggaggaggaaggcaggtaccacgaccgt
gacagggatcgtgatagaaatcgcgatctccgtcgcgatcgtgagcatagtagagatcat
agaggcgatcgggatcacaggtacgaccgagatcgagacatagatagaggtagaggtaga
ggtaggagtaatagaagagatgattacggcgaccatagagcttatagtgatgacgacgaa
agcgatgatggtattaggcatgggagaacccgttctagtagaaggatttcggatgaaccg
gagctttatgaggtttacaaggggaaggtattgcgtctgatggacaatggttgctttgtt
gaactttctgatttcagagggaaggaagggcttgttcatgtttcacagattgcaaataga
agagtaaccaatgcaaaggacgaggtgaagcgtggtcaggatgtatatgtgaaagtgatc
tctgtttctgggaaaaagctaagtttatccatgagggatgtggatcaaaacaccgggaag
gatctccttccactaaggaaaagcacagagaatgaagctttaaggaccaacccctctagt
gggaacagcggtccagttgcaaggaaaggcctctcggggattaccatttttgaggatgat
aataatgcatcgtccaggaggcctttgaagaggatgagctcgcctgagaagtgggaagcg
aagcagctaattgcagctggtgttctggatgttcgtgaatatccaatgtttgatgaagag
ggggatggattgctgtatcaggaagagggtgctgaagaagaacttgagattgaactcaat
gaggatgaacctgcgtttttgcaaggccagagtcggttttccattgacatgtctcctgta
aagatcttcaaaaatccagaaggctctttaagtagggctgcagctctccagtctgctctc
atcaaggagaggagagaagttcgtgagcagcaacagagaaccatgcttgattccattcca
aaggatcttaatcgaccatgggaagatccaatgccagagacaggtgagaggcacctagca
caggagctgagaggtataggtttgtcagcttatgacatgccagaatgggagaaagatgca
tatgggaaagctttgacatttggccaaagatcaaaactttcaatacaagagcataggcag
agtcttccaatctacaaattgaagaaggagctgattcaggccgtgtatgataatcaggta
ttggttgtcattggtgaaactggctctgggaagacgacacaggtgactcaatacttagcc
gaggcaggttataccacgaaagggaaaattggatgcacacagccccgtagggtggcagca
acttcagttgcaaaaagggtggcagaggagtttggttgtcggttgggtgaggaagtcggc
tatgctattaggtttgaagactgtacaggtccagaaactgtgataaagtatatgatagat
ggtatgcttctgagggagattttggttgatgacaacctttcccagtattctgttatcatg
cttgatgaagctcatgagaggacaatccacacagatgtgncgcttgtgaaacgtaggcct
gaacttcggttgattgtcacctccgcgacattggatgcagagaagttctcccgttatttc
tttaactgcaatatcttcacaattcctggtagaacatttcctgttgaggtactctacacg
aagcatccagaaagtgattatctggatgcagtactgatcacagttctgcagattcacttg
acagaacctgagggagacattcttcttttcttgactggtcaggaagagattgatcatgct
tgccagtctctttatgagagaatgaagggcctggataagaatgtgcctgaactgattatc
ttgcctgtatacagtgctcttccaagtgaaatgcaatcgagaatttttgagccggctcct
cccggtaagagaaaagttgttgtagctactaatattgcagaggcttctttgacaattgat
ggaatattttatgtaattgaccctgggtttgctaagcaaaatgtgtataaccctaaacag
ggtcttgattctctggtcatcactcctatatctcaagcatcagctaagcaaagggctggc
agggcgggccgtactggtccaggaaaatgttatcgtctttataccgagagtgcctatcgc
aatgaaatgtcacctaccacaattccagaaattcagaggattaatcttgggacaacaact
ttgaatatgaaggctatggggattaatgatctcttgtcttttgattttatggatcctcca
tcacctcaggcccttatatctgcaatggaacaactgtatagtctaggagctttagatgaa
gagggacttttgactaaattagggagaaaaatggcagatttcccattggatcctccatta
tcgaagatgttacttgccagtgtggaccttggatgcagcgatgaaatcttgaccatcatt
gcaatgattcaaactggcaatattttctataggccaagggagaagcaagcccaggcagat
cagaagcgggccaagtttttccaaccagaaggtgaccacttgactttgcttgctgtttat
gaggcgtggaaagctaagaacttttctggcccttggtgttttgaaaacttcgtacagtcg
cgttctcttaggagagctcaagatgtcaggaagcaacttctcactattatggataggtat
gattttgatgaactcgcttctttttcttctgtaagaaacaacgatctgcttcatgtttgg
tag

DBGET integrated database retrieval system