KEGG   Phalaenopsis equestris: 110026035Help
Entry
110026035         CDS       T05601                                 

Definition
(RefSeq) aldehyde dehydrogenase family 7 member B4
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
peq  Phalaenopsis equestris
Pathway
peq00010  Glycolysis / Gluconeogenesis
peq00053  Ascorbate and aldarate metabolism
peq00071  Fatty acid degradation
peq00260  Glycine, serine and threonine metabolism
peq00280  Valine, leucine and isoleucine degradation
peq00310  Lysine degradation
peq00330  Arginine and proline metabolism
peq00340  Histidine metabolism
peq00380  Tryptophan metabolism
peq00410  beta-Alanine metabolism
peq00561  Glycerolipid metabolism
peq00620  Pyruvate metabolism
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
Module
peq_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110026035
   00053 Ascorbate and aldarate metabolism
    110026035
   00620 Pyruvate metabolism
    110026035
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110026035
   00561 Glycerolipid metabolism
    110026035
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110026035
   00280 Valine, leucine and isoleucine degradation
    110026035
   00310 Lysine degradation
    110026035
   00330 Arginine and proline metabolism
    110026035
   00340 Histidine metabolism
    110026035
   00380 Tryptophan metabolism
    110026035
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110026035
Enzymes [BR:peq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110026035
    1.2.1.8  betaine-aldehyde dehydrogenase
     110026035
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     110026035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110026035
NCBI-ProteinID: XP_020582445
Position
Unknown
AA seq 508 aa AA seqDB search
MGFLKKEYQFLSGIGLGPRNPGCYLNGAWRATGPVVASLNPANNEVIAEVVEASIDDYEE
GMKACFDASKIWMQLPAPKRGDIVRQIGDALRAKLQHLGRLVSLEMGKILPEGIGEVQEI
IDMCDFAVGLSRQLNGSVIPSERPNHMMMEIWNPLGVVGVITAFNFPCAVLGWNACIALV
CGNCVVWKGAPTTPLITIAMTELIAGVLEKNNLPGAIFTAFCGGAEIGQAIARDIRIPLV
SFTGSSKVGLMVLQTVNERFGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQRC
TTCRRLLLHENIYQEFLDQLIGVYKQVKIGDPLDKGTLLGPLHTPASKENFVNGIEVIKS
QGGKILTGGYAIESKGNFVQPTIVEISSDAQVVKDELFGPVLYAMKFKTLKEAIEINNSV
PQGLSSSIFTRRPEVIFKWIGPLGSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAGSD
SWKQYMRRSTCTINYGSELPLAQGINFG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctcaagaaggagtaccagttcctctcggggattggcctaggcccccgcaat
cccggctgctatctgaacggcgcatggagagctaccggaccggtggtcgcctcgttgaat
cctgccaataacgaggttattgctgaagtggtggaggcttcaatcgatgactatgaggaa
gggatgaaggcctgctttgatgcttccaagatatggatgcagttaccagctccaaagagg
ggtgacattgttaggcagattggcgatgcattgagagctaaactccaacaccttggtagg
ctcgtttcacttgagatgggaaaaatactacccgaagggattggcgaagttcaggaaatt
attgacatgtgtgactttgctgttgggttgagccgacaactaaatggatcagttatacct
tcagaacgtcctaatcacatgatgatggagatttggaatcccttgggtgtagtgggtgtt
ataactgccttcaacttcccttgtgctgtacttggatggaatgcctgtattgcactggtc
tgtggtaactgcgttgtatggaaaggcgcaccaacaaccccactaattactattgcaatg
accgaactaattgctggagtattggagaagaacaatttaccaggcgcaatttttacagca
ttttgtggaggtgctgaaattggtcaagcaatagctcgtgacatacggatacctcttgtt
tcatttactggaagttccaaggttggccttatggttctacagacggttaatgagagattt
ggaaaatgtttgcttgaacttagtgggaacaatgcaataattgtcatggatgatgctgac
atacaacttgctgttcgctcagtcctatttgctgctgtcggtactgctggacaacgctgc
acaacttgcaggaggctgctacttcatgaaaacatataccaagaatttctagatcaactg
attggtgtatacaaacaagttaaaataggggaccctttggataaaggtaccttactaggg
ccactgcacactcctgcttccaaggagaactttgtaaatggaatcgaagttatcaaatct
caggggggaaaaattcttactggaggatatgccatagaatctaaaggaaactttgtgcaa
cctacaatagtagaaatatcttcggatgcacaagttgtcaaggacgagttatttggtcct
gtcctttatgccatgaaattcaagacattgaaagaagcgatagaaataaataactcagtg
cctcaaggtctaagtagctcaatattcacacggaggccagaggtcatcttcaagtggatt
gggccacttggcagtgactgcggcattgtaaatgtcaacattccaactaatggtgccgaa
attggtggtgcttttggtggcgaaaaggcgactggtggtggtcgagaagcaggaagtgac
tcatggaaacaatacatgcgacgttctacttgcacaatcaactatggaagcgagctcccg
ctggctcagggaatcaacttcggctaa

DBGET integrated database retrieval system