KEGG   Phalaenopsis equestris: 110026590Help
Entry
110026590         CDS       T05601                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
peq  Phalaenopsis equestris
Pathway
peq00970  Aminoacyl-tRNA biosynthesis
peq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:peq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110026590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:peq03029]
    110026590
Enzymes [BR:peq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     110026590
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     110026590
Mitochondrial biogenesis [BR:peq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    110026590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 110026590
NCBI-ProteinID: XP_020583247
Position
Unknown
AA seq 543 aa AA seqDB search
MSFLIQNPRLILPAHRLPLSLSPLRNPRQLLHGATIPSATLSSPHSNLSSSEILSIRDSL
LSGRRTASEIAGEYLERLHKVEPKIRSFLYVSESAMKEAEAVDRMVAAGRQLSPLAGVLI
GVKDNICTFDMPSTGGSKILKGYRPAFDATAVRRLREAGAIVVGKTNLDEFGMGSSTECS
GFQVTANPWDLSRVPGGSSGGSAAAVSARQCVVSLGSDTGGSVRQPASFCGVVGMKPTYS
RVSRFGLMAYASSLDVIGCFGSSVADVSILLNVISGHDRLDSTSSKRDVPDFANELASLN
NFDSKPLKGLRVGLIRETIGEGVDAGVSSAVQAAASHLEHLGCVVNEISLPSFSLGLPAY
YILALSEASSNLSRYDGVRYGNQVGNEELSSLYGSSRSIGFGDEVKMRILMGTYALSAGY
YDAYYKKAQQVRTLIQKCFKDAMNDNDILISPAAPSAAYKIGEKANNPLAMYAGDIMTVN
VNLAGLPALVVPCGFVEGGPVGLPVGLQIIASAFCEDALLRVGYIFEQTLQNHRFVPPLY
GSS
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcctaatacaaaaccctcgcctcatcctccctgctcatcgcctccctctttcc
ttatcaccgttgagaaacccacgccaactactacatggcgcgaccatcccctcagccacc
ctctcctctcctcacagcaatctcagctcctcagagatcctctctatccgagattctctc
ctctccggacggagaacggcctctgaaatcgctggagaatacctagagcgcctccataag
gtggagccgaaaattcggagctttctttatgtgtcagagtctgcaatgaaagaggcggaa
gcggtggaccgaatggtcgcagctgggaggcagctgtccccgctggctggtgttctcatt
ggtgtgaaagataacatctgcacctttgatatgccttctacgggcggatcgaagattctg
aagggttataggccagcgttcgatgccactgcggtgaggaggcttagggaggcgggagcc
attgtcgtggggaaaacgaatttggatgagtttggaatggggagcagcactgagtgttct
ggatttcaggtcactgcaaatccttgggatctgtcacgtgttcccggagggtcatcaggg
ggatcagctgccgctgtttccgccaggcagtgtgtcgtatctttgggaagtgacactggc
ggtagtgttaggcagccggcatccttctgtggcgttgttggaatgaaaccaacctatagt
cgagtttctcggtttgggctcatggcttatgcatcatcattggacgtcattggctgtttt
ggttcttctgttgctgatgtatcgattcttcttaatgtgatttctggtcacgacagattg
gattctaccagcagcaagcgagatgtgccagactttgcaaatgagttggcctcactaaat
aattttgattcaaaacctttaaagggattaagggttggactgattcgggaaactattgga
gaaggagttgatgcaggagtttcttcagcagtgcaagctgccgcttcacatctggagcat
ttaggatgtgttgtaaatgagatatcattgccttcattttctcttggcctgcctgcttac
tacatattggctttatcagaggcatcttctaatttatcacgttatgatggtgtaaggtat
ggaaaccaggttggaaatgaagaactgagttctctttatggtagctctagatcaattggt
tttggtgatgaggtcaaaatgagaatcctaatgggaacatacgcactctccgcgggctat
tacgacgcatactataaaaaagcgcagcaggtgagaacattgattcaaaagtgtttcaag
gatgcaatgaatgacaatgacattctcatttcacctgctgctccatcagctgcttataag
ataggtgaaaaggccaacaatcctctagcaatgtatgctggtgatatcatgactgttaat
gtcaacttggctgggctcccggcccttgttgtgccatgcgggtttgtagaaggtggacca
gttggtcttcctgtcggacttcagataattgcttcagccttttgtgaggatgcattgttg
agggttggctatatctttgagcaaacgcttcagaaccacagatttgttccaccactatat
ggatcaagctag

DBGET integrated database retrieval system