KEGG   Phalaenopsis equestris: 110026664Help
Entry
110026664         CDS       T05601                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 6
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
peq  Phalaenopsis equestris
Pathway
peq00520  Amino sugar and nucleotide sugar metabolism
peq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    110026664
Enzymes [BR:peq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     110026664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind NAD_binding_10 KR
Motif
Other DBs
NCBI-GeneID: 110026664
NCBI-ProteinID: XP_020583353
Position
Unknown
AA seq 349 aa AA seqDB search
MAKEASNGEQYTVTRPPPTPSPLRFSKFFQANLRILVTGGAGFIGSHLVDKLMENEKHEV
IVVDNFFTGSKDNLKKWIGHPRFELIRHDVTEPLLVEVDQIYHLACPASPIFYKYNPVKT
IKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLQHPQTEEYWGNVNPIGVRSCYDEGK
RVAETLMFDYHRQHGLEIRIARIFNTYGPRMNIDDGRVVSNFIAQAIRGESLTVQAPGTQ
TRSFCYVSDMVDGLIRLMEGDNTGPINIGNPGEFTMMELAETVKELINPDVCVKIVENTP
DDPRQRKPDITKAKNLLGWEPKVVLRDGLPLMEEDFRQRLDVPNKNNFK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaggcatccaacggagagcagtacaccgtgacccgtccccctccaactcct
tctcctcttcgattttccaaattctttcaagccaatctgaggatcttagttacgggagga
gctggattcattggatctcatttggtcgataagctgatggaaaatgaaaaacacgaggtt
attgttgtggataacttctttaccggttcaaaggataacctcaagaaatggattggacat
ccaagatttgagcttatccgacacgatgttactgaaccgttacttgtggaggttgatcaa
atatatcatcttgcttgcccagcctctcctattttctataagtacaatcctgtgaagaca
ataaagaccaatgttattggcaccttaaacatgttgggccttgcaaagagagtcggagca
aggattttgctgacatctacttctgaggtttatggtgatcctcttcagcaccctcaaaca
gaagaatattggggcaatgttaaccccattggtgtgaggagttgttatgatgagggtaaa
cgcgtggcagagactcttatgtttgattatcataggcaacatggcttagaaattcgaatt
gccagaatattcaacacatatggacctcgtatgaatattgatgatggtcgtgttgttagc
aattttatagctcaagcaatccggggagaatctttaacagttcaagctcctgggactcaa
actcggagcttctgctatgtatctgatatggttgatggtctcatacgtttgatggaagga
gacaatactggccccataaatatcggaaacccaggtgaattcacgatgatggaacttgct
gaaacagtcaaggagttgataaacccggatgtttgtgtgaaaatagtggagaacactcct
gatgatccgcgccagaggaaacccgacatcaccaaggccaagaatttactcggctgggag
cctaaggtcgttcttagagatggtttgcccctcatggaagaagacttcaggcagaggcta
gatgttcccaacaaaaacaacttcaaatag

DBGET integrated database retrieval system