KEGG   Phalaenopsis equestris: 110028379Help
Entry
110028379         CDS       T05601                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
peq  Phalaenopsis equestris
Pathway
peq00071  Fatty acid degradation
peq00410  beta-Alanine metabolism
peq00592  alpha-Linolenic acid metabolism
peq00640  Propanoate metabolism
peq01040  Biosynthesis of unsaturated fatty acids
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
peq01200  Carbon metabolism
peq01212  Fatty acid metabolism
peq04146  Peroxisome
Module
peq_M00087  beta-Oxidation
peq_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    110028379
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110028379
   00592 alpha-Linolenic acid metabolism
    110028379
   01040 Biosynthesis of unsaturated fatty acids
    110028379
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110028379
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110028379
Enzymes [BR:peq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     110028379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 110028379
NCBI-ProteinID: XP_020585870
Position
Unknown
AA seq 441 aa AA seqDB search
MAAVASQKQGSGNKSEEDMRSHIGLPALEISAAFPQATPATIFPAMTSDYYQFDDLLNSE
ESSLRKNVRNVMEKEIAPIMAKCWEKAEFPFHVIPKLAALNVAGGTIKGYGCPGLSITAS
AVSLAEIARVDASCSTFVLVHSSLAMLTIGLCGSEAQRQKYLPSLARFSTVACWALTEPD
YGSDASSLSTTATKVNGGWLLEGQKRWIGNSTFADVLVIFARNTSTNQINGFIVRKGSPG
LSATKIENKIGLRIVQNGDILLKKVFVPDEDRLPGVHSFQDTSKVLAVSRVMVTWQPIGI
SMGVFDMCHRYLKERKQFGAPLAAFQINQIKLARMLGNIQAMLLVGWRLCKLYESGKMTP
GQASLGKAWTSNKARETVSLGRELLGGNGILADFLVAKAFCDLEPILSYEGTYEINSLVT
GREITGIASFKPAVLGKVSRL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtggcatctcagaagcaaggttctggtaacaaaagcgaagaagacatgaga
tctcatattggattgcctgcattggagatctctgctgcttttcctcaggcaaccccagcg
acaatatttcctgccatgacttctgattattaccaatttgatgatttgctaaattccgag
gagagttcattgcgaaaaaatgtccgaaatgttatggaaaaagaaattgctccgattatg
gcaaagtgctgggagaaggcagagtttcccttccatgttattccaaagcttgctgctctg
aatgttgctgggggaacaataaagggttatggttgtccgggactttcgatcactgctagt
gctgtttctttagcagagattgctagagtcgatgctagctgttccacctttgtattggtt
cattcttcattagcaatgcttacaattggactttgcggatcagaggcgcaaagacagaaa
tatttaccatcgttagcacgatttagtacagttgcatgttgggctttaactgagcctgac
tatggaagcgatgcaagctctttgagtaccactgcgacaaaggttaatggaggttggtta
ttggaaggacagaagcggtggataggaaacagcacgtttgccgatgtcctggttattttc
gctcggaacacaagtacaaaccagattaacgggtttattgtgaggaagggttcccctggt
ttaagtgctaccaaaatagaaaacaaaattgggctaagaattgttcagaatggagatatt
ctattaaagaaagtatttgtcccagatgaggataggttaccaggtgttcattcctttcag
gacacaagtaaggtactcgccgtttctcgcgttatggttacatggcagccgatcggcatt
tcgatgggcgtatttgacatgtgccatcggtatcttaaagaacggaagcaatttggagcc
ccactcgccgcattccaaatcaaccagataaaactagctcgcatgctcggaaacattcaa
gccatgcttcttgttggttggcgcctctgcaagctatatgaatcgggaaagatgactcct
ggtcaggctagcttggggaaggcttggaccagcaataaggccagggaaactgtttctctt
ggcagagaactacttggtggcaatggtatcctggctgacttcttagtggcaaaggcattc
tgtgatctggagccaatactttcttatgaagggacttatgaaatcaatagcttggtgact
ggaagagaaattacggggattgcaagctttaagcctgctgtgctgggtaaagtaagccgc
ctttaa

DBGET integrated database retrieval system