KEGG   Phalaenopsis equestris: 110029030Help
Entry
110029030         CDS       T05601                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
peq  Phalaenopsis equestris
Pathway
peq00480  Glutathione metabolism
peq00590  Arachidonic acid metabolism
peq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110029030
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110029030
Enzymes [BR:peq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     110029030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 110029030
NCBI-ProteinID: XP_020586796
Position
Unknown
AA seq 170 aa AA seqDB search
MSSVASQSAKSVHDFTVKDARGEDVDLSIYKGKVLLIVNVASQCGLANSNYTELTQLYDK
YKDKGLEILAFPCNQFAGQEPGSNEEIVEFACTRFKAEYPIFDKVDVNGKEAAPIYKFLK
SSKGGLFGDSIKWNYSKFLVDKEGHVVDRYAPTTSPLSIEKDIKKLLETS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgtggcttcgcagtcggctaaatccgtccacgatttcaccgtgaaggatgct
cgtggtgaagatgttgacctcagcatctacaagggcaaggttttgctcattgttaatgtc
gcgtctcaatgtgggttagcaaactcaaattatactgagctgactcagttgtatgacaag
tacaaggataaaggtctggagatattggctttcccatgcaatcagtttgcaggtcaggag
ccaggaagcaatgaggagattgttgaatttgcctgcacgcgcttcaaagctgaataccct
atctttgataaggttgatgtcaatggaaaagaagccgcccccatctacaagttcctcaag
tcgagcaaaggggggctttttggcgatagcatcaaatggaactactccaagttcttggtc
gataaagagggtcatgtcgtggaccgctatgctcccaccacctcccccttgagcattgag
aaggatatcaagaagcttctggagacttcttag

DBGET integrated database retrieval system