KEGG   Phalaenopsis equestris: 110029165Help
Entry
110029165         CDS       T05601                                 

Definition
(RefSeq) serine/threonine-protein kinase RIPK-like
Organism
peq  Phalaenopsis equestris
Brite
Enzymes [BR:peq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110029165
Protein kinases [BR:peq01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110029165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase PIP49_C
Motif
Other DBs
NCBI-GeneID: 110029165
NCBI-ProteinID: XP_020586990
Position
Unknown
AA seq 427 aa AA seqDB search
MGSCMSTGNSHEVSKKLASKQNSLRKVSSTRMNGSEVSLSPEDLSISLAGSNLYIFTFAE
LQMVTGGFSTCNFLGEGGFGPVYKGVIDERVRPGMESQSVAVKLLDLEGLQGHKEWLAEV
IFLGKLRHPHLVRLIGYCYEDQHRLLVYEYMIKGSLENHLFKRFFISLAWSTRLKIAVGA
AKGLAFLHEAEKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDNSHVTTRVMGTQG
YTAPEYIMTGHLTAKSDVYSFGVVLLELLTGRRSVDKTRPSREQNLVEWARPYLNDARKL
SRIMDSSLDGMYSTKAAQRAATVAYQCLSQRSKSRPPMSAVVDALEPLLDLNDEMIGSFV
FTVVPDNGGNEEKKKDCNEDGNHSGGERRKMWSAKAAIHSNNLMYRNSSRHQHRNGGRGL
DQDVQCK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggctcctgcatgagcacaggcaacagccatgaagtttcaaagaagctcgcctcaaag
cagaactctctcagaaaggtatcttctacaaggatgaacggatcagaagtctcactctct
ccagaagacctctccatctctcttgcaggctccaacctctacatcttcaccttcgcagag
cttcaaatggtgacggggggattctccacctgcaactttcttggagaaggaggcttcggg
cctgtatacaagggggtcattgatgagagagtgaggccaggcatggagtcccagtccgtt
gcagttaagctcctggatctcgaaggtctgcagggacacaaggaatggctggctgaagtg
atatttttaggaaaactgaggcatccccatcttgtgagattgataggttattgctatgag
gatcagcataggctgcttgtctatgaatatatgataaaaggaagcttggagaatcacctg
ttcaaaagattcttcatatccttagcatggtcaacaaggctgaagattgcagtgggagca
gcgaagggactggccttcctccatgaggcagagaagccagtgatatacagagattttaag
gcttctaacatcttgttagattcggactacactgcaaagctttcagatttcggactcgcg
aaggacggccctgaaggagacaacagccatgtcacaacaagagtcatgggaacacaggga
tacactgcaccagaatacataatgacaggccatctcacagcgaaaagtgatgtgtacagc
ttcggtgttgtattgctagagctacttacagggagaagatcagtagataaaacgaggcca
agcagagagcaaaaccttgtagaatgggcgcggccttacctgaacgatgccaggaaacta
tcgaggataatggacagcagtctggatggcatgtactccaccaaggctgcacagagagca
gcaacagtggcgtaccagtgcttgagtcagagatccaagtccaggcctccgatgtccgcc
gttgtagatgcactggagcctctcttggacttgaatgatgaaatgataggctcctttgtg
ttcacagtggtgcctgataatggcggaaatgaggaaaagaagaaagattgcaatgaggat
ggaaaccacagtgggggagaaaggcggaagatgtggtctgcgaaagcggcaatccactcc
aataatttgatgtacagaaactcatcaagacaccagcataggaatgggggaagaggattg
gatcaggacgtgcagtgcaaatag

DBGET integrated database retrieval system