KEGG   Phalaenopsis equestris: 110029458Help
Entry
110029458         CDS       T05601                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
peq  Phalaenopsis equestris
Pathway
peq00010  Glycolysis / Gluconeogenesis
peq00562  Inositol phosphate metabolism
peq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110029458
   00562 Inositol phosphate metabolism
    110029458
Enzymes [BR:peq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110029458
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110029458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110029458
NCBI-ProteinID: XP_020587419
Position
Unknown
AA seq 520 aa AA seqDB search
MTLTESDTIVFLLLLFFCSSLSAAATPVATDESFNVRLHLSTVSSYEAGKETTFDSYVPS
TIPQGCSPIHLNLLARHGTRSPTKKRIKELDQLSIRLDDLLNQAKHGGKSHLNKIPSWLP
GWQSPWKGRQKGGELISKGEDELYQLALRIRKRFPELFNEEYHPDIFSIRATQVPRASAS
AVAFGIGLFQGNGTLGPGMHRAFSVTSESRASDISLRFYDTCETYKEYRKSQEPAVDKLK
EPIFEEIAAKLVQHYELNFTRKDVASLWFLCKQEASLLDITDKACSLFSAYEVELLEWTD
DLELFILKGYGKSINYLMGLPLLQDVVHSMEEAILAKEENHKPGTFEKARLRFAHAETVV
PFTCLLGIFLQMPEFELIRRDEPLSLPPKPPQPRTWRGSVVAPFSVNIMLVLYQCPGNIS
HSGAESKGYKSKYYLQALHNEIPAPMPGCGYQDFCDFEVFKENIVNTHLKQNFQSVCTVK
AKEDLPPENCSIACRLLNFIRNFFQRDSHGNTKVNRKNEL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgactcttaccgagagcgataccattgtcttccttctcctactcttcttctgctcctct
ttgtccgccgctgctacccccgttgctaccgatgagagtttcaacgttcgtctgcacctc
tccaccgtctccagttatgaagccggaaaagaaactacctttgattcttatgttccttct
acaatcccacaagggtgtagtcctatccacttaaatctgttggcaaggcatggaactcga
tctcccactaagaagcggattaaagagttggatcaattatcaattcgcttagatgatctg
cttaatcaggcaaaacatggagggaagagccatttgaacaaaattccatcctggttgcct
ggttggcaatctccttggaaaggtaggcagaaaggaggggagctaataagtaaaggagaa
gatgaactttatcagctagctttaagaatacggaaaagatttccagaattgttcaatgag
gaatatcacccggatatattctcaattagagccactcaggttcctcgtgcatcagctagt
gctgtggcatttggcattggtctttttcaaggtaatgggaccttagggccagggatgcat
cgagcattttccgtgacgagtgagagtcgtgcaagtgatatttctctacggttttatgat
acttgtgaaacttataaggaatatcggaaaagtcaggaacctgctgttgataagctcaaa
gagccaatttttgaggaaattgctgccaagcttgtccaacattatgaacttaatttcact
aggaaggatgtggcttcgctttggtttctctgtaagcaggaagcatctttattggacatt
actgacaaagcttgtagccttttttctgcttatgaggttgaattactcgagtggaccgat
gacttagagttatttatattaaaaggttatggtaaatcaataaactatctcatgggactc
ccattgcttcaagatgttgttcactcaatggaagaagcaattttggccaaagaagaaaac
cataagcctggaacttttgagaaggcaaggctcagatttgctcatgctgaaacagttgtt
cctttcacctgtcttcttgggatttttcttcaaatgccagaatttgaactaatacgaagg
gacgagccattaagtctgccgccaaaacctcctcaaccacggacttggaggggaagtgtc
gtcgctcctttcagtgtaaatattatgttggttttgtaccaatgtcctggcaacatttca
catagcggtgctgaaagcaaaggttacaaaagcaagtactatttgcaagctctgcacaac
gaaattccagctcccatgccgggctgtggctaccaggatttctgcgatttcgaggttttc
aaggaaaacattgtcaatactcatctgaagcaaaactttcaatcagtctgcactgtaaag
gcaaaggaagatcttccaccagaaaactgttctattgcatgcagactcctgaattttata
cgtaatttctttcaaagagattcacatggcaacaccaaagttaaccgaaagaacgagtta
tga

DBGET integrated database retrieval system