KEGG   Phalaenopsis equestris: 110030905Help
Entry
110030905         CDS       T05601                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 2-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
peq  Phalaenopsis equestris
Pathway
peq00520  Amino sugar and nucleotide sugar metabolism
peq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    110030905
Enzymes [BR:peq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     110030905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 110030905
NCBI-ProteinID: XP_020589544
Position
Unknown
AA seq 433 aa AA seqDB search
MASELIYRGHEAQPLGDALYSPKPMKRWPSLPRPVRYLLREQRLIFLVAGMGLAAIVLAL
APRSPATPREIAGAAHVMVGMAAMAEKRWQVFEPVRMGSVGGKVPLGLKRKGLRVVVTGG
AGFVGSHLVDRLIERGDNVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVDQI
YHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRIGARFLLTSTSEVYGDPLQHPQVE
TYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGAQVEVRIARIFNTYGPRMCIDDGRVVSN
FVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMKLMEGEHVGPFNLGNPGEFTMIELAQ
VVQETIDPNARIEFRPNTEDDPHKRKPDITRAKELLGWEPKVPLRKGLPLMVSDFRKRIF
GDHPTSSSSASAV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggagctcatctaccggggccacgaagctcagcctctcggtgatgccctctac
tcgccgaagccgatgaaacggtggccatcgcttccaagaccggtgcggtatcttctacgg
gagcagcggcttatcttcctggttgccgggatgggtctagccgcgattgttttggcgttg
gctccgagatctccagcgactcctagggagatagcaggggcggcgcacgtgatggttggg
atggcggcgatggccgagaagcgatggcaggtgtttgaaccggtcaggatgggttctgtt
ggggggaaagtgccgctagggttgaagagaaaggggcttagagtagtggttaccggagga
gcaggatttgtagggagccatctggtggatcggctgattgaaaggggggataacgttatt
gtggtggataatttttttaccgggaggaaagagaatgtcatgcatcatttcggaaaccct
aatttcgagttgatccgtcacgatgtcgtcgagccgctgcttctcgaagttgatcagatc
taccaccttgcatgtcccgcttcccctgttcattacaagtttaatcccgtcaagacgatc
aagaccaacgttgtgggaactctcaacatgcttggattggccaagaggatcggcgcccgc
ttcctcctcactagcaccagcgaagtctatggcgatcctcttcagcacccgcaggtcgaa
acatattggggcaacgtgaatcccattggggttcgaagctgctacgacgaagggaagcgg
acagccgaaactctgaccatggattaccaccgcggagctcaagtcgaagtgaggatcgct
cggatcttcaacacgtacgggcctcgcatgtgcatcgatgatggccgggtcgtcagcaac
ttcgtcgcccaggcattaagaaaggaaccgctaacggtatacggggacgggaaacaaacc
cgaagcttccagtacgtatcagacctagtggaagggctgatgaaactaatggaaggcgaa
cacgtgggccccttcaacctgggaaaccccggcgaattcaccatgatcgagctcgcgcag
gttgttcaggaaaccatcgaccccaacgcgcgcatcgagtttcgccccaacaccgaagac
gacccccacaaacgcaagcccgacatcacccgcgccaaagagctcctcggctgggaaccc
aaggtaccccttcgcaaaggcctccctctcatggtttccgatttccgtaaacgcattttt
ggcgatcaccccacctcttcttcctctgcttcggcggtttga

DBGET integrated database retrieval system