KEGG   Phalaenopsis equestris: 110031145Help
Entry
110031145         CDS       T05601                                 

Definition
(RefSeq) putative cysteine-rich receptor-like protein kinase 20
Organism
peq  Phalaenopsis equestris
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung TMEM154 DUF4448 Haspin_kinase SKG6 DAG1 DUF3827 Pkinase_fungal CD34_antigen Podoplanin Shisa ABC1 Herpes_gE
Motif
Other DBs
NCBI-GeneID: 110031145
NCBI-ProteinID: XP_020589872
Position
Unknown
AA seq 559 aa AA seqDB search
MSSPTSLAFLLLVLLSLFASPATAYLLYNVCGSTGNFSTYSTYSSNLNVLLSTLSSNASA
TGFATFTTGSIPDSVTGLILCRGDTDIFNCRSCIHTAIKEIRQFCPNQKDASIWYDLCLL
RYSSQNFLYAPDITSNIKVFMFNTQTVSAEQLSPTNGSSTANTTRPTADSSHGGSSKVGT
VVAITVPVVVAIVLISTISIWLCRRKPRRKQPGEANLEEFSKVETILFDLPTLKVATENF
SELNKVGEGGFGSVYKGVLPDGQEIAVKRLSAGSGQGLEELKNELVVTALLHHKNIVRLY
GVCLEKTEKLLIYEYAPNKSLDTILFDPTKSKLLDWMKRCEIIGGIARGLLYLHEDSQLK
IIHRDLKASNILLDVDMNAKISDFGMARIFRGDESQGKTSNVVGTCGYMAPEYGLHGHFS
DKSDVFSFGVLVLEILTGRSNKSFFNDDHSEDLLSYVWKNWKNGTVLEIVDPTLAKPLPR
SEVMRCFQIGLLCAQHDFSQRPTMITVVVMLNSYSMSIEAPSAPAFFAGVSGINTEEFSR
KFDIYENDTYKPSSKKMPM
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcccacttccctggctttcctcctcctcgttctcctatccttgttcgcctct
ccggcaacagcatacctactctacaatgtctgcggcagcacaggaaacttctccacttac
agtacctacagctccaacctcaacgtccttctttccaccctttcctccaacgcctctgcc
acaggcttcgccactttcacaacaggcagcattcccgatagcgttaccggccttatcctc
tgccgtggtgacaccgatatcttcaactgtcgctcctgcatccacaccgccataaaagag
atccggcagttctgcccaaaccagaaggacgccagcatatggtatgatttatgcctactc
cgctactccagccaaaacttcctctacgctcccgacatcacctcaaacatcaaggttttc
atgtttaacactcaaactgtctcggccgagcaactgtcgcctacaaacgggtcttccacg
gcaaatactacccggcctacggcagattcatctcatggaggaagcagtaaagtgggcact
gttgtggcaatcacagttcctgtagtagttgcaattgttctaatttccacaattagcatc
tggttgtgtcgaagaaaaccaaggagaaagcaacccggcgaggctaaccttgaagagttt
tccaaggttgaaactatattgtttgatttacccacacttaaagtagcaactgaaaatttc
tcagaacttaacaaggttggtgaagggggcttcggatcagtttacaagggagtattaccg
gatggtcaagaaatagcagtcaagaggctctcagcaggatcagggcaagggcttgaagag
ctaaaaaatgaactggttgtaacagctctactccatcacaaaaatattgtaagactatat
ggtgtctgcctggaaaaaacagagaagttgctcatatatgagtatgcgcccaacaaaagc
ttagatacaattctctttgatccaacgaaaagtaagctactagactggatgaaaagatgc
gagatcataggagggattgcccgtggcttgctttacctacatgaagactcccaattaaag
atcattcatcgagatcttaaagctagcaatatattgttagatgtagacatgaatgcaaaa
atttcggactttgggatggctagaatttttcgaggagatgagagtcaagggaagacgagt
aatgttgttggaacgtgtggatatatggctccagaatatggattgcacggacatttttca
gacaagtctgatgtatttagttttggagtgctagttttagagattttaacaggaaggagt
aataaaagtttctttaatgatgaccattctgaagacctcttaagttatgtatggaagaat
tggaagaatggaacagtcctagaaattgtagacccaaccttagcaaaacctcttccgaga
agtgaagtcatgcgatgctttcaaattggacttctttgtgcacaacatgacttttctcaa
agacctacaatgataacagtggttgtcatgctcaacagctattctatgtccattgaagcc
ccttcagcgccagctttttttgcaggggtaagtggcataaacacagaggagttttcaagg
aaatttgacatatatgaaaatgacacttacaaaccttcaagcaagaagatgccaatgtga

DBGET integrated database retrieval system