KEGG   Phalaenopsis equestris: 110031150Help
Entry
110031150         CDS       T05601                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 6
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
peq  Phalaenopsis equestris
Brite
KEGG Orthology (KO) [BR:peq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:peq01001]
    110031150
Enzymes [BR:peq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110031150
Protein kinases [BR:peq01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110031150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung Haspin_kinase Kdo APH
Motif
Other DBs
NCBI-GeneID: 110031150
NCBI-ProteinID: XP_020589877
Position
Unknown
AA seq 466 aa AA seqDB search
MGNTSDLAVRNNSLLFATGEMALSTGHIIYGLVQCVRYLTATDCRTCLQDSVDQITRDPL
KGRRGGRTLGTWCNMRYEFYKFYNGSSMLQLPSAQPPSPSPLPSPHGGETNPEEITNVES
ILFDLSTLKVATMNFSERNKLGEGGFGSVYKGLLPDGREIAVKRLSKGSRQGLNELRNEL
ILVAKLQHKNLVRLHGICLEEQEMLLVYEYLPNKSLDTILFDPAKSELLDWEKRYNIIEG
IARGLLYLHEDSQLKIIHRDLKASNILLDANMAPKISDFGLARLFEGEETYGMTIHVVGT
CGYIAPEYGMHGHFSFKSDVFSFGVLILEVITGRSIGFFNVELDEYLLSYVWENWKNGTI
LKILDQALCKPFQNSEVIKCIQIGLLCVQKDPAQRPTMTQVIVMLTSHSVSLKTPSSPAF
FVERSGVKHSTLSGKSNMQGEDHHNSPNKFIPMSPNELTISEVDPR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacacgtccgatctcgccgtgagaaacaattcgctgctgttcgccaccggagag
atggcactctcgacggggcacatcatatatggacttgtgcagtgcgtgcgttatctaaca
gcaaccgattgccggacatgcctgcaggattcggtggatcagatcaccagggatcctctg
aaagggaggaggggaggaaggacgttggggacgtggtgcaatatgagatatgagttttac
aagttttacaacggttcgtccatgctgcagcttccttctgctcagccgccgtcgccgtcg
ccgttgccgtcgccacatggaggtgagacaaaccccgaggagattacaaatgttgaatct
atattgtttgatctatctacacttaaagtagcaacaatgaatttctctgaacgtaacaag
cttggtgaaggtggcttcggatcagtttataagggattgctacctgatggacgtgaaata
gcagtgaaaaggctatcaaaaggatcgaggcaagggcttaatgagctaagaaatgaactt
attctagttgctaaactccagcacaaaaatcttgtaagactacatggtatttgtcttgag
gaacaggagatgttgctcgtttacgaatatttacccaacaaaagcttagataccattctc
tttgatccagcaaaaagtgaactactggactgggagaaaagatacaatataatagaagga
attgctcgtggcctactttacctacatgaagactcccaactaaagatcattcatagggat
cttaaagctagcaatatattgttagacgcaaatatggctccaaaaatatcagactttggc
ttggccaggctgtttgaaggagaagagacttacgggatgacaattcatgttgttggaaca
tgtggatatattgctccagaatacggaatgcatggacatttctcattcaagtctgacgtc
tttagttttggagtactaattttagaggttataacaggaaggagcattggtttcttcaat
gttgagcttgatgaataccttttaagctatgtttgggagaattggaagaatggaacaatc
ttgaagattttggaccaagctttgtgcaaaccatttcaaaacagtgaagtcataaaatgc
attcaaattggacttctttgtgtgcaaaaggatccagctcaaaggcctaccatgacacaa
gtgattgtgatgctcactagtcattccgtgtctcttaaaactccttcttcaccagctttc
tttgtggagagaagtggcgtcaaacatagtacactttcagggaaatctaacatgcaaggg
gaagaccatcacaactctcctaacaagtttatcccaatgtcacctaatgaactgacaatt
tcagaggtagatcctagataa

DBGET integrated database retrieval system