KEGG   Phalaenopsis equestris: 110032545Help
Entry
110032545         CDS       T05601                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: PTI1-like tyrosine-protein kinase At3g15890
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
peq  Phalaenopsis equestris
Brite
KEGG Orthology (KO) [BR:peq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:peq01001]
    110032545
Enzymes [BR:peq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110032545
Protein kinases [BR:peq01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110032545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 110032545
NCBI-ProteinID: XP_020591865
Position
Unknown
AA seq 430 aa AA seqDB search
MGSMISSCCGEEKVTQGFVGGGSESATWRLFTYKELHVATNGFSEDYLLGEGGFGSVFWG
KTADGHQIAVKKLKGMTSKAEMEFAVEVEILGRVRHKNLLGLRGYCAGAEQRLIVYDYMP
NLSLLSHLHGQFSTDTQLDWKKRMNIITGSAEGLVYLHHEAAPHIIHRDIKASNVLLDSN
FEPLVADFGFAKLMPDGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLELVS
GRKPIEKLAGGIQRPITEWAQPLIXXXXXXXXXGESASQQLRRIIHAASRSVQPEPDRRP
TMRQVLDIVIGTALAADPVKNSKLGYGKDSEVAGSSGVSSNSGTLRLKSINYGKELMDMD
DDNSNYGDNEYDDDDDDDERERELSNSSGDWGNGKTGGKYGVFGAIEVQKMGRNNYGQQV
AGNRLTALRG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgatgataagctcttgctgcggcgaagagaaggtcacccaaggatttgttggc
ggaggatcagaaagcgccacctggaggttgttcacttataaggagcttcacgtggccacc
aatggcttcagtgaagactatttgcttggcgagggaggatttggaagtgtgttttggggg
aaaacggctgatggacatcagatagccgttaaaaagctgaaaggcatgacttcgaaagct
gagatggaatttgcggtggaggtagagatacttggaagggtgaggcacaagaacctgttg
ggactcagaggatattgtgctggagcggaacagaggcttattgtctatgattatatgcca
aaccttagcttgctgtctcatcttcatggccaattttctacggatacgcagctggactgg
aagaaaaggatgaacatcattactggttcggcagaagggcttgtgtatctccaccacgag
gcagcgccgcacatcatccaccgcgacataaaggccagcaacgtattgctggactccaat
ttcgagccgctggtggcggatttcggattcgccaagctgatgccggacggcgtcagccat
atgaccactcgtgtgaaaggcacgctcggctatctcgcccccgagtacgccatgtggggc
aaggtctccgagagctgcgacgtctacagcttcggcattctcctcctcgagctcgtctcg
ggccgcaagcccatcgagaagctcgccggcgggatccaacgcccaatcaccgaatgggcc
cagccactcatcnnnnnnnnnnnnnnnnnnnnnnnnnngggcgagtccgccagccaacaa
ctccgccgcataatccacgccgcttcccgatccgtccagcccgaaccggaccgcaggccc
accatgcgccaggtgctcgatatcgtgatcggcacagctctagccgctgatccggtgaag
aacagcaagctaggttacggcaaggacagcgaagtcgcggggagttcgggcgttagctcc
aactccggcacattgaggttgaagagcatcaattatgggaaagagctgatggacatggat
gatgacaacagcaattatggcgataacgaatacgatgatgatgatgatgatgatgaacgg
gaacgtgagttgagcaatagcagcggcgattgggggaatgggaaaactggcggaaagtat
ggggtttttggggcaatagaggtgcagaagatggggaggaacaactatggacaacaagtc
gccggcaatcggctgacggcgctgcgcgggtga

DBGET integrated database retrieval system