KEGG   Phalaenopsis equestris: 110032771Help
Entry
110032771         CDS       T05601                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP15-1-like
  KO
K09569  FK506-binding protein 2 [EC:5.2.1.8]
Organism
peq  Phalaenopsis equestris
Brite
KEGG Orthology (KO) [BR:peq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:peq03110]
    110032771
Enzymes [BR:peq01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110032771
Chaperones and folding catalysts [BR:peq03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    110032771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 110032771
NCBI-ProteinID: XP_020592177
Position
Unknown
AA seq 153 aa AA seqDB search
MRAMRRILSCVALLAVLVLFVSAKKSRDVTELQIGVKYKPESCSIQAHKGDRVKVHYHGM
LTDGSTFDSSYERGDPFEFELGSGQVIKGWDQGLLGMCIGEKRKLKIPAKLGYGESGSPP
KIPGGATLVFDTELIAVNGRTSTSDEDTGDEEL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgatgaggaggattttaagctgcgttgcgttattggccgttctagttctattt
gtctctgctaagaaatcccgcgatgttacggagctgcagatcggcgtcaagtacaaacca
gagagttgtagcattcaagctcacaaaggcgatagagttaaagtgcattatcatggaatg
ctcactgatgggagtacattcgactctagttatgagagaggtgacccctttgagtttgag
cttggcagcggtcaagtgatcaaagggtgggaccaagggctgcttggaatgtgcattggc
gagaaaaggaagctgaagatccctgcaaagcttggctatggtgaatcaggatctcctccc
aagattcctgggggagcgacgctggtctttgataccgagcttattgctgtcaacggaaga
acttcaacaagcgatgaggatacaggagatgaagagctataa

DBGET integrated database retrieval system