KEGG   Phalaenopsis equestris: 110033192
Entry
110033192         CDS       T05601                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
peq  Phalaenopsis equestris
Pathway
peq00100  Steroid biosynthesis
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110033192
Enzymes [BR:peq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110033192
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 110033192
NCBI-ProteinID: XP_020592756
Position
Unknown
AA seq 369 aa
MDLAALLHSFIPSWSSAGILLSYLVYLALAGAILPGKTVPGAVLSDGTRLHYRCNGLASL
FVLMALLGIGIIMKFVSPTVIADKGAQLFSITFIFSVIVTLLLYITGSKSRDKSSSLRAR
VTGNLLHDWWFGVQLNPHFMGVDLKFFFVRAGLMGWLFINLSIFSKSLQAGDANLSVILY
QLFCALYVIDYFFYEEFMTSTWDVIAESLGFMLVFGDLVFIPFTFSIQGWWLLGNKVELS
KVAAFMDCLIFLIGYLIFRGANKQKHVFKKDPKAPIWGKPPKVIGGKLLASGYWGISRHC
NYLGDLLLAFSFSLPCGASSVIPYFYPIYLLVLLVWRERRDDSRCSEKYREIWGEYCNQV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggacctggccgctcttctacattccttcatcccatcgtggagctcagcaggcatactc
ctgtcgtaccttgtttatctagcgctggccggcgccattctgcccggaaagaccgttcct
ggtgccgtgctctccgatggcacccggctgcactaccgatgcaacggtttagcttcacta
tttgtattgatggctcttttagggattggcattatcatgaagtttgtatctccaacggtc
atagctgacaagggagcccagctgttttcaatcacttttatattcagtgtgattgttact
ctacttctgtacattactggaagcaagtcccgtgataagagctcctctctaagagcacgt
gtcacaggaaaccttttgcatgactggtggtttggtgtacaactaaatcctcacttcatg
ggtgtcgatcttaaattcttttttgtccgagctggtttgatgggatggctgttcatcaat
ctctctatcttctcaaaaagtcttcaagctggcgatgcaaatctctctgttattctttac
cagctattttgtgcgctgtacgttatagattacttcttttatgaagagtttatgacttca
acgtgggatgtgattgcggagagtttgggcttcatgttggtctttggagatctagtattc
attcctttcacttttagcattcagggttggtggcttttgggaaacaaagtggaactttct
aaagtagccgcctttatggattgcctgatttttctcattggctatctaatatttcgagga
gctaacaagcaaaagcatgtttttaaaaaggaccccaaagctcccatatggggcaagccc
ccaaaagtaattggagggaaattgcttgcatctggttactggggaatttcaaggcactgc
aattaccttggagatttactactggcattttcattcagtttgccatgtggagcaagttct
gtaattccatatttctatcccatttatctgctagttctgttggtgtggagggagaggaga
gatgattccaggtgctctgagaagtacagagaaatctggggagagtactgcaaccaggtt
ccctggaggattctgccatatgtttattaa

DBGET integrated database retrieval system