KEGG   Phalaenopsis equestris: 110033972Help
Entry
110033972         CDS       T05601                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL19
Organism
peq  Phalaenopsis equestris
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kinase-like Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110033972
NCBI-ProteinID: XP_020593828
Position
Unknown
AA seq 430 aa AA seqDB search
MKCFNFIISEKKEDLQCTKSSSIRSCSTTSTDPDVKRSGSEISSLATSDTSADSRRRSRL
QSFSQRASNLRVFSVTELKNATKSFSRSVMIGEGGFGCVYRGTIRGSDDPNSKIEIAVKQ
LGRRGLQGHKEWLTEVTFLGIVEHPNLVKLIGYCAEEDERGPQRLLIYEYMPNRSVGDHL
LARSTMPLSWPMRLRIALDAARGLSYLHEGMDFQIIFRDLKTSNILLDEQWNAKLSDFGL
AREGPEEGSTHVSTAVVGTLGYAAPEYMHTGRLTVKSDIWSFGVVLYELITGRSPIDRNR
PKNEQKLLEWVKPYISDIKKFRMIIDPRLDVRSSLKSAMRLSTVANRCLVRQAKLRPRMT
EVMEMLQRIVDGTLNGAPQPPLKPVGLQEEGFEESKKKGLDLKRRLSELKMGEGKRLVWR
RWTPKLVKTH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcttcaatttcattatatcagaaaagaaagaagatcttcaatgcacaaaatct
tcatcaattagatcctgtagcacaacctcgactgatcctgatgtcaagagatcaggatct
gagatcagctcattagccacatccgacacgagcgctgattcgagaaggaggtctcggttg
cagagtttctctcagagagcaagcaatctgcgagttttttctgttactgaacttaagaat
gccacaaaaagctttagtcgttcagtaatgattggagaaggtggctttggatgcgtttat
aggggaacaattaggggttctgatgacccaaattctaagattgaaattgcagtgaaacag
ctaggccggagagggttacaggggcataaagaatggttgacagaagtaacttttctcggc
attgttgagcatccaaatcttgttaagttaattggctattgtgctgaagaagatgaaagg
gggcctcagaggcttcttatttacgagtacatgcctaatagaagtgttggggatcatctg
ttagcccgatcaaccatgcctctttcgtggccgatgagattaaggatagctcttgatgct
gctcgtggcttgtcgtatcttcacgaaggaatggactttcagattatatttcgggatctc
aaaacttccaacattctcttggacgagcagtggaatgctaagctctcagacttcggcttg
gccagagaaggcccagaagaaggttcaactcatgtttctacggcggtcgttggaacgcta
ggctatgcggctcctgaatacatgcataccggtcgactcactgtcaagagtgacatatgg
agtttcggggttgtcctctacgaactcatcaccggccgcagccccattgatcgcaatcga
ccaaagaacgagcaaaagctcttggagtgggttaaaccatacatctccgacatcaagaag
ttccgaatgataatagatccgaggctcgacgttcgctcctctctgaaatctgcaatgcgg
ctgtcgaccgtcgcgaaccggtgccttgtgcggcaggcgaagttgaggccgaggatgact
gaagttatggaaatgttgcagagaattgtggacggcacattgaatggggctcctcagcct
ccattgaagccagttgggcttcaggaggaagggtttgaagagagtaaaaagaaggggttg
gatctgaagagaaggttgagtgaattgaaaatgggagaggggaagaggttggtgtggaga
agatggacaccaaagcttgtgaaaacacactaa

DBGET integrated database retrieval system