KEGG   Phalaenopsis equestris: 110036080Help
Entry
110036080         CDS       T05601                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2
Organism
peq  Phalaenopsis equestris
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr B_lectin PAN_2 PIP49_C CbtA
Motif
Other DBs
NCBI-GeneID: 110036080
NCBI-ProteinID: XP_020596091
Position
Unknown
AA seq 764 aa AA seqDB search
MFSKPSILLFLLLCCFPALATPGPDATITVGSFITADKSNSEAAAWFSPSRQFGFGFYSV
GNEFAVGIWFVPNRTIVWTADRDGELIPENSKLHLAEDGIQIPSPNGDRSIANISTTAKL
ASAMMLDCGNFIIMDVNNIITWQTFDNPTDTLMSGQVLKAGNKLVSSVSATNHSSGRFQI
VMQEDGNFFARPVNTPDTSAHFYWSSNTSGDGYTGILLGINEPDGFLRIYKTSSNLAQFA
SELPDDDNGFDMCSIKGACGQNSYCSFTAGVANTSTGFVQGEVACLCFPGYDYTDRSKPY
MGCEKNFSMGQCVTDNNFSYSITKLTNISWSDDPYTYSDHSTEKDCRDSCLHDCNCYAAL
FFSCQRCSKQRLPLLYGRSIESTVAFLKVGSGQMQLPPQLPAEEAIVKVPRRKTLLLSMA
LASVLIVSLAVTIIIFYKNRDPSYKRLCRNMETGLSGGLAPRFFTYHQLGVVTDGFTKPL
GKGGFSTVFRGEIPLNNGEVMPIAVKRLDKKLSAVNEKGFRTEMRAVGRAHHRNIVRLLG
FCHEGPKWLLIYEYMSRGSLAHLIFPKDKAHARPSWKERSGMAMDVARGLLYLHEGCDNI
IIHSDIKPENVLVGEDGTAKIGDLGLAKLLRPRQSETYTSPRGTFLYQAPEWRKDATEPV
SPKVDVYSFGVLLLELITCRKYFLGDAENDSSILSELVYKCLIESTLERLVPEGENVNMA
ELKIMVMVALWCVQEVPGQRKSMKEVVRMLGGNMSIPMPPDSLV
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgttttctaagccttctatcctcctttttctcttgctctgctgctttccagcactcgca
acgccaggaccagatgcgacgattaccgtgggctcgttcatcaccgccgacaaaagtaac
tcggaggccgcggcctggttttccccctcccgccaattcggcttcggtttctactcggtg
gggaacgaatttgccgtcggcatatggttcgtccccaacagaaccatcgtatggacggct
gaccgcgatggtgagctcatccctgaaaatagcaagctccatctcgctgaagacggaatc
cagatacccagccccaacggcgatagatctatcgcgaacatctccaccactgcaaagctt
gcgtcggccatgatgctagattgcggtaacttcatcatcatggacgttaacaacatcatc
acttggcagaccttcgacaaccctaccgacaccctcatgtctggccaggtactcaaagcc
gggaacaaactagtctccagcgtctcagccaccaaccactcaagcggaaggtttcagatc
gtgatgcaggaggacggaaacttctttgcgcgcccagtaaacaccccagacacttccgcc
cacttttactggtcctccaacaccagcggcgacggctacaccggcatactccttggcata
aatgaaccggacgggtttctgcggatatacaagaccagcagtaacttagcgcagtttgca
agcgaactgccggacgacgacaatggcttcgatatgtgctccataaaaggcgcgtgcggc
caaaacagctactgcagttttaccgccggagtcgctaatacttccaccggcttcgtccaa
ggagaggtggcatgcctctgctttcctggctacgactacactgaccggagcaaaccgtat
atgggttgcgagaagaatttctccatgggacaatgcgtcacagataataacttctcgtac
tccatcaccaaactgactaacatttcttggagcgatgacccgtatacttactccgaccac
agcacggagaaggattgccgtgactcgtgtttacacgactgcaactgctacgccgctctg
ttcttctcgtgccagagatgcagtaagcaaaggcttccgctcttgtacgggaggtcgata
gagtccaccgtcgcgtttctcaaggttggctccggacagatgcagctgccgccacaacta
ccagctgaagaagcgatcgttaaagtcccgagacgaaaaactctgcttttaagcatggcg
ttagcttcagtgttaatcgtttctctggctgtaacgatcatcatcttctacaaaaaccga
gaccctagctacaaaaggctgtgcagaaacatggagaccggcctgtcgggagggttggcg
ccgcggttctttacgtatcatcagctaggagtggttacagacggttttaccaaacccctt
gggaaggggggtttctccacagtattcagaggggaaatccctctgaacaacggcgaggtg
atgcccatagcggtgaaacggctggacaagaaactgtcggcggtgaacgagaaagggttt
cgcactgagatgagagccgtgggacgagcgcatcaccgaaacatcgtgcggttgctcgga
ttctgccacgagggacccaaatggttgctcatttacgagtacatgagccggggctcgctc
gcccacctcatcttcccaaaagataaggcccatgcccggccaagctggaaggagaggtct
ggcatggctatggatgtggccagaggactcctctaccttcacgaaggatgtgacaacatt
atcatccacagcgacatcaagcccgagaatgtgctcgtgggcgaagatggcacggccaag
attggcgacctcggattggcgaagctacttaggccgcggcagtcagagacatacactagc
ccaagggggactttcctctaccaagcaccggaatggagaaaggatgcgactgagcctgtg
tcgcccaaagtcgacgtctacagcttcggcgttctcctgcttgagctgataacctgcagg
aagtactttttgggcgacgcggagaatgacagcagcattctgtccgagctggtttataag
tgcttgatagagtcgacattggagcggttggtgccggaaggagagaacgtgaacatggcg
gagctgaagattatggtcatggtggcgctctggtgcgtgcaggaggtgcctggtcagcgc
aagtccatgaaggaagtggtccgcatgctgggaggaaatatgagcataccaatgcctccc
gattctcttgtctag

DBGET integrated database retrieval system